ϱſ@0 HPD! HBPHCPHC6PHPF׀ @HPG @HCPHC4PHPD HCRPHC\PH APH APH APH AݧPH A٧P HAP HAާP HAڧP HA֧P HAҧP HAΧP HAʧP HAƧP HA§P HAP HAP HAP HAP HAPHBPHCPH !APH "APH #APHCPĀ̠H &APH 'A}PHCPHPC HCPH +AmPH ,AiPH -AePH .AaPH /A]PH 0AYPH 1AUPH 2AQPH 3AMPH 4AIPH 5AEPH 6AAPH 7A=PH 8A9PH 9A5PH :A1PH ;A-PH <A)PH =A%PH >A!PH ?APH @APH AAPH BAPH CA PH DA PH EAPH FAPH G@PH H@PH I@PH J@PH K@PH L@PH M@PH N@PH O@ݧPH P@٧PH Q@էPH R@ѧPH S@ͧPH T@ɧPH U@ŧPH V@PH W@PH X@PH Y@PH Z@PH [@PH \@PH ]@PH ^@PH _@PH `@PH a@PH b@PH c@PH d@PH e@PH f@PH g@}PH h@yPH i@uPH j@qPH k@mPH l@iPH m@ePH n@aPH o@]PH p@YPH q@UPH r@QPH s@MPH t@IPH u@EPH v@APH w@=PH x@9PH y@5PH z@1PH {@-PH |@)PH }@%PH ~@!PH @PH/<0C4DHH @PHA§PH @ PH @PH @PH ?PCʡH/</0CHH ?PH ?PH ?PH ?PH ?PH ?ݧP/</0CpHH ?էPH ?ѧPH ?ͧPH ?ɧPH ?ŧPH ?PH ?PH ?PH ?PH ?PH ?PH ?PH ?PH ?PH ?PAuHAuHHĀ̠H ?PH ?PH ?PH ?P CMHH ?yPH ?uPH ?qPH ?mPH ?iPH ?ePH ?aPH ?]PH ?YPH ?UPH ?QPH ?MPH ?IPH ?EPH ?APH ?=PH ?9PH ?5PH ?1PH ?-PH ?)PH ?%PH ?!PH ?PH ?PH ?PH ?PH ? PH ? PH ?PH ?PH >PH >PH >PH >PH >PH >PH >PH >PH >ݧPH >٧PH >էPH >ѧPH >ͧPH >ɧPH >ŧPH >PH >PH >PH >PH >PH >PH >PH >PH >PH >PH >PH >PH >PH >PH >PH >PH >PH >}PH >yPH >uPH >qPH >mPH >iPH >ePH >aPH >]PH >YPH >UPH >QPH >MPH >IPH >EPH >APH >=PH >9PH >5PH >1PH >-PH >)PH >%PH >!PH >PH >PHP@ H>PH?PH?6PHPB׀ @HPC @H?PH?4PHP@ H?RPH?\PH =PH =PH =PH =ݧPH =٧P H=P H=ާP H=ڧP H=֧P H=ҧP H=ΧP H=ʧP H=ƧP H=§P H=P H=P H=P H=P H=PH>PH?PH !=PH "=PH #=PH?PĀ̠H &=PH '=}PH?PHP@ H?PH +=mPH ,=iPH -=ePH .=aPH /=]PH 0=YPH 1=UPH 2=QPH 3=MPH 4=IPH 5=EPH 6=APH 7==PH 8=9PH 9=5PH :=1PH ;=-PH <=)PH ==%PH >=!PH ?=PH @=PH A=PH B=PH C= PH D= PH E=PH F=PH G׀ @HP? @H;PH;4PHP< H;RPH;\PH 9PH 9PH 9PH 9ݧPH 9٧P H9P H9ާP H9ڧP H9֧P H9ҧP H9ΧP H9ʧP H9ƧP H9§P H9P H9P H9P H9P H9PH:PH;PH !9PH "9PH #9PH;PĀ̠H &9PH '9}PH;PHP< H;PH +9mPH ,9iPH -9ePH .9aPH /9]PH 09YPH 19UPH 29QPH 39MPH 49IPH 59EPH 69APH 79=PH 899PH 995PH :91PH ;9-PH <9)PH =9%PH >9!PH ?9PH @9PH A9PH B9PH C9 PH D9 PH E9PH F9PH G8PH H8PH I8PH J8PH K8PH L8PH M8PH N8PH O8ݧPH P8٧PH Q8էPH R8ѧPH S8ͧPH T8ɧPH U8ŧPH V8PH W8PH X8PH Y8PH Z8PH [8PH \8PH ]8PH ^8PH _8PH `8PH a8PH b8PH c8PH d8PH e8PH f8PH g8}PH h8yPH i8uPH j8qPH k8mPH l8iPH m8ePH n8aPH o8]PH p8YPH q8UPH r8QPH s8MPH t8IPH u8EPH v8APH w8=PH x89PH y85PH z81PH {8-PH |8)PH }8%PH ~8!PH 8PH/<0;45!PH ?5PH @5PH A5PH B5PH C5 PH D5 PH E5PH F5PH G4PH H4PH I4PH J4PH K4PH L4PH M4PH N4PH O4ݧPH P4٧PH Q4էPH R4ѧPH S4ͧPH T4ɧPH U4ŧPH V4PH W4PH X4PH Y4PH Z4PH [4PH \4PH ]4PH ^4PH _4PH `4PH a4PH b4PH c4PH d4PH e4PH f4PH g4}PH h4yPH i4uPH j4qPH k4mPH l4iPH m4ePH n4aPH o4]PH p4YPH q4UPH r4QPH s4MPH t4IPH u4EPH v4APH w4=PH x49PH y45PH z41PH {4-PH |4)PH }4%PH ~4!PH 4PH/<0748HH 4PH5§PH 4 PH 4PH 4PH 3P7ʡH/</07HH 3PH 3PH 3PH 3PH 3PH 3ݧP/</07pHH 3էPH 3ѧPH 3ͧPH 3ɧPH 3ŧPH 3PH 3PH 3PH 3PH 3PH 3PH 3PH 3PH 3PH 3P5uH5uHHĀ̠H 3PH 3PH 3PH 3P 7MHH 3yPH 3uPH 3qPH 3mPH 3iPH 3ePH 3aPH 3]PH 3YPH 3UPH 3QPH 3MPH 3IPH 3EPH 3APH 3=PH 39PH 35PH 31PH 3-PH 3)PH 3%PH 3!PH 3PH 3PH 3PH 3PH 3 PH 3 PH 3PH 3PH 2PH 2PH 2PH 2PH 2PH 2PH 2PH 2PH 2ݧPH 2٧PH 2էPH 2ѧPH 2ͧPH 2ɧPH 2ŧPH 2PH 2PH 2PH 2PH 2PH 2PH 2PH 2PH 2PH 2PH 2PH 2PH 2PH 2PH 2PH 2PH 2PH 2}PH 2yPH 2uPH 2qPH 2mPH 2iPH 2ePH 2aPH 2]PH 2YPH 2UPH 2QPH 2MPH 2IPH 2EPH 2APH 2=PH 29PH 25PH 21PH 2-PH 2)PH 2%PH 2!PH 2PHdrSp@U <@`0-< <,`< @ 8@8`X(o!@< 88l   ˆ@@`$:I€``QH"(ƀH( !ȁ) ʀ @̠ҁ2`*`ԂDcԢʠ6!€@(`€D0`(`ĀDcĠ+ < ` - Đı  <  -̐`̱`   <  -̀`̡`<`@`      ͜swapper<L&t&t&㿘<|#`  @F , &@ @ ,     ?N - @ ? ?&@㿘      <     <      <     < <     <  )    <     < 1<.<.!̆ᜄ ;   ` < ?㿘0!<3  !0 j2 @H@P0? !0 *<        %<< " ? <@ P  )      ` $   ` $<.!p#<. <.at! ;     $<at! ;       $<       $<࠘       $<ఆ    8< $<@ 2 0LP)<X!\)<.#h`%#hTX`hpxLP@DHX#;@;H;P;X;`;h;p;x#@#D#H#L#P#T/  @$;@DHPX`hpx@DHLPT )<.#h%`%#h;p;x;;#T;X;`;h@#L#@#D#HT/<^K'<+<b+<b 1 9@ % -  , +<%b+<%b/<+<b,@` `--``--`-/<^%+<%b/<%ⴁ @̀+<%b+<%b/<^%P)<X!\/   @ 3@)<X!\ @V)<X!\ '/ @ ˒@/ ͬ/ @E@ X<32 (  +<c @* @ @ "ဥ @ 2#`@/   @C@C)<X!\ X<32 `(  @+<c @* @@ #`@/  @Eo) #@@ %` @/  @I%`@E)<X!\/|"Ҳ@ @FN@ -)<X!\|'.К@ Ԋt& Ҳ@/  @E)|!@/ @@0)0~@/ v @) P)<X!\ @@Ā̠)<X!\ @@ @)<X!\ @@-@Ӭ)<X!\ @@/@Ǭ)<X!\ @@ז+<Va@ +<V`@+<Va @`+<Vax @`)<X!\ @@)<X!\ @@R)<X!\ @@gw)<X!\ @@ti)<X!\ @@[)<X!\ @@M)<X!\ @@?)<X!\  @ @$sH`#D#H-H`#D#H4 `Ā̠(`+<,  Ā̠)<X!\+</a @--@/  Ԃ@" ҂@ ؂@" ւ@@E̐@  !!   ) ꅀ@@-o5 @ @)<@ z)?w @)?@* @`)< 5` -0k@` =)<# *)<%  %$%)<  %%%%  %   /@%%`%% %%%   ' @' @ @`-!`' @-!)?@ @-<%@5 '8)@@)<5`)<  , 05` )@@)< %  @̀)<X!\ ` * @Fy@K$#@-5` `@)<X!\ ` * @E}@1!** -<,/<04     ŀ@@@'@` @+@@#@@@h @@@` @*@@` @*@@` @*@B@` @*ڬ@:@` @*ЬH P9@@yEH`P"*`9@@y&HP9!#<΁bx@/< ㈮-@*l p @kpa(`)<X!\P ` ݪ#p=@ (#@H`#D7#H #p #@H`#D,#H@**`#D'#H/</ʮ0`;``*`w" )<X!\P @*q@#p=@(#@  #p#@H``#D#H$`#Ha*(`/<֮P)<X!\ #p=@(#@  #p#@H`#D#H*@@ @  2*@@": : : : : : (: 0: 8: @: H: P: X: `: h: p: x*@*@      ( 0 8 @ H P X ` h p x @1@#2b<3 <+  <4@#' ``P)<X!\ #P@@w  *Ho  P2* 2!`!( </<3l P)<X!\<cp *p`P/  @1=@('<V0H, ` 4,@ `) </)<3l  @"-`;;;;; ;(;0;8 @̀!`_;;;;; ;(;0;8 @̀H`@.!9999 9(90989@ !(P= !p#@#D#H#T;X;`;h@#L;p;x;; p# @Df()`@!e!@)`@9c9c9c9c 9c(9c09c89c@!@1``!( @̀;H`` H`8oʃ1``8H9```8Hʁ@1``H <@#@ʀ`ʠ;;;;; ;(;0;8)`ʠ$@#ʁ@`"mHs4 ,4 @ (08 @̀;+)</+<3!l `@+cp%`T=`X=``=`h@%`LH+cp;p;x;;#@#D#H )@!!( @Dߐ (08 @̀ 0Š 8;``/0⃀8< ``04``⃀04``0+<#@` (08- $@#@` ,`,  @)-'%`@%`D%`H%`T=`X=``=`h@%`L=`p=`x=`=`Š84,;;;;; ;(;0;8Š)+</)<3al )#p@ -%`@%`D%`H%`T=`X=``=`h@%`L=`p=`x=`=` ? @!( 0, (!Š`4,(@!(;``$ `8o ƒ0``88```8€@0``;;;;; ;(;0;8Š<@(€((  (8888 8(80888@ 0!(Š` ;;;;; ;(;0;8(` $@#€@`Š4 0`0`'<:)<:!XT@  @ U@g" @@ƒ@@ (   @[@px P,4 c@DH@@L`TX`h @̀DH@ @ (@0`@P(0@``L`pxTX`h@DH (08L`pxTX`h@DH @̀ @DR@v`8?oć88`Ā@䁔0ćށ02؁ (08u<@Ȃ#@€`  (08(` $Ā#€@`Y0㿘`<@z"< 0#@z 㿘<@z# %Ҁ@&Ԁ@<@zz#@<@zw#X@ i@㿘<@zo#p<@zl#X@ ^@u㿘 <#?  < ,   > @zV   <@zO#㿘<@zI#`<@zC @ 5 `H#<!<'<@z)`( 8     " <@z8`@ @@N @L 㿘0  !0<3 j2 ` `<@y P< x`@ @_4 0"!< ! @_' 0? !0<3 *㿘0  !0<3 j2 @<< ",`@)j " 0 !! @^ 0? !0<3 *㿘0  !0<3 j2 @" <R !! @^ה 0`!0<3 *㿘0  !0<3 j2  @"  < L@yw <!0(!! @^ 0`!0<3 *㿘0  !0<3 j2] @<!8H@ ` &` 0<.<.#xct 10 !`!0<3 *㿘0   !0<3 j2$ H  @%0<D<D<D<D `*@A&%%%%p  @ 0@`@J# 001 * $$"$"쀎@$  <@xِ!h <. & &  "<! @^ <.* &"0? !0<3 *㿘0  !0<3 j2 @" <V!!! @]۔ 0`!0<3 *㿘0  !0<3 j2 @"0<@vB!? !0<3 *㿘0  !0<3 j2  @] 0`!0<3 *㿘0  !0<3 j2j  @] 0`!0<3 *㿘0  !0<3 j2T  @]r 0`!0<3 *㿘0  !0<3 j2>  @]X 0`!0<3 *2 02 002 0Z2 0z2 02 0׀2 0F2 0d2 0{2 02 02 0㿘<, <<@5"@㿘<",` @S 9</*   F<c(@U<3`   @ 3<7<<<5#4c%<,``*"@ *`@  @<0 @  c8   +@/   <#@%<#<  HcP  @  @X*㿘<",` @@0R</  ,`` <#` `<# 0    2 2 <#  @<#@wB0'  <  @w90@A@ ,` $ ,` "  @5  `@u@C㿘##<3 `<@w 8</`L`L<%<'<` H`@w:`<a,` .  @vX $. @v`</ `H< @ @v h<b  @vX?<@v`@㿘</ `H  <3 <<*ሒb @    }x!#<?`x H ?㿘</ L L : @ :  @@㿘H //--<3 ȓHo`<!- z}x</`Jj 9</ I m J  !<a ? J 2l@ }x7</<" La-1</L :  :   J@ 2C/ I H >J*%</#</+<?3`?H*/ *H/ L L@ :  2ݠ? `J ؒ`J@  H 2Ѡ?j@ 2͠?0/ I<3 `<*`  </ I ` </* IJ(H(H@ <!<3ȅ( 2 </<3I"  㿘`  ` `0&h`H/ 0H*/ 0<@u 㿘 `</ * #<<@u H<!@u%< 5<<@u!( 8 @  $@uaH@sKP㿘##<3 `@ڐ<!,` </ " L @%   </<5</ `J ,`". *  `",`  2    L @$@"㿘!!<3 @<!,  </ " L @$Ş  <5</ `J , "ᜐ* "@`L @$Þ,  @g" 㿘  `</?,      @@<@r!p<<@r!@t!l?C</ <* <* c ""@tՔ  @n  I<", <`@<  @< " @" " 2` @! " 2(R@@ #)3    2$$$ $ $$$ $ @ %% % % % % "@ ?㿘<",`  @D_ ``</W?*`     @@` `` 2`  <@tM"H7? S</ <* <* c ""@t2  @˒  2$P?$ $ $ $ `$ $` "@q?   㿘%%<3 Ȁ </ `  </`*@  <#@s 0 @* N <# ` " <# , `"@  㿘%%<3 Ȁ ( </ `  </`*@ ` <#@s͒ 0 @*  <# `" # , `"@ ߐ0  <c  "Ґ</༑* <c   </༑* <c  㿘` </ `` </`*@  <<#@s< @*<# . `"@ 㿘` </ `` </`*@  <<#@sb< @*<# . `"@ < "@<H#d#<H* #d#<H* 㿘!<D!<c@ː㿘 </ `  </`*@  <#@s0 @*㿘! n</!  @  `0   `0 ` `%0 *@㿘 K</!  @ `0   `0`` 0*@<#d#㿘    </*   </  <<D!8 x< !-*`   2 <``  ` db@,<3`   @ 7<<<5#4c%<,``*"@ *`@  @ @  Ѐ   + @/<.-.-    <")<'<  "  @  <``<D@ᜑ* @a8` ᜲ <@ϒt</㿘  </ . @<!.  @ `<""     2 2  <# @<#@@r0"  < #x@q0N  $ $@@ @ @:㿘##<3 `</.! |Ғ@@ *в@<!,` </ " L @!W<5</ `J ,`"* .``"</  ,` ,`   2J</?+`@В?+`*  Ҳ,``:  0 *:``/ +  * <!-+ @ @ @* 0@,`@ ,@    2E``Θ</ L @ <!@?"@</*`  (l * X㿘?  ` ^?<!.  </ . @   @@` `` 2`  <@q#6?  V</ <* <* c "#@p  @  2$?$ $ $ $ `$ $`$@( <2 P %H/`</dh2*|Ғ</D  ( @Ҳ</d( <2 P %H`</dh2[*|ؒ</D  ( +Ʋ</d(:`(*  ( |Р@<t#d#!* Ђ!* Ң㿘 !<D<` @ ڐ!( !(</!D  <`@ А!(!(20x20㿘?!@_6! @\n@㿘` ?  㿘 #??b< `<"0`@ @ 㿘 #<#??Ib@ R 2*< ` <"0` @  Lb@ Lb b@ y <@  <@m 㿘<3 ` @ *@㿈 <     #\ #d#`@o  << !P#d $ ( , 0 4 8#\@o#`㿈%%<3 ȡH/`</aj2g  < ! $ ( ,#\ 4#` 8#d <@o|#h 8  a<  " 0a* 㿘㿘<e     @ 㿈<     %<   #\ #`@o8#d < $!P ( , 0 4 8#\ <#`@o*#d @< D! H L P T X#\ \#`@o#d 8 `"@?@oP`? 㿘< "` @o  < " @n  < $" (@n , 0< 4" 8@n << @#  D H@n L+ H㿘@H 0*@!㿘@!(!`H 0k*@!8?` !< c ? !8!@㿘@"H 0尔B*@! @㰐?   < < <    (< < < ( 0 8 @< 0< 8 H< @< H??   :::   (:: :( 0 8:0:8<Ub&&/&& @</"0 &$ H8&< &8  H@ @E$ (&$ H8? ?&<&8 H :8p" & ` @  <;  @F  2 < 8 @;@ ?& 8 "p p `@ 2$ H?` $ 4$ 0' 4 㿘 V!&`&@ &` `&`   <&` @&&`@<&`TD0&`XH`&`\L &``P&`dT&`hX&`l\&`pp (,#@ p&`xp <" &`| H 0 @&`a(&a&a &a&a$@ &a㿘 2!@ 8.`@0H 0E*@&*@!0 @ǐ &`   .`.``.`*``@` *"@  @R*` 㿘0  `? !0<3 j2H `*`@ <` ` **  @@ĥ 0? !0<3 *㿘 ِ `  2 0@[{@@[~@2 0TxxTTxTTxxxxxxxxxxL``LL`LL㿐?"Ho`j2< ''"@"`昔+ *@ @ "*H*o``  # &`&`!@X@&`0&@ @ 㿘㿘`0㿈`  <; @      &0J&@!*@'Ho`j2 ''!!&&&&* *@ @ # *H*o`  ! &&!@Xz&0& @ 㿈@` " 0 H);<   ?`dh y ` P@'< , @ &ഐ`/@"*&<* @ 1!  ? ?0@ `!`!  `@ ఐ'@ /@!*@'Ho`j2# !!昔+ *@ @ "*H*o`0n@Ő ;< @  ?򀢠` `^` `T `'h`@ J @!*@'Ho`j2 !!昔+ *@ @ "*H*o`& & `& H` & 0`& `  < * @& @P_ 㿀@ H);<   ?` @ @@ & @ <@" < * @@&8/@@"*&<*  1!  ? ?0@ !!  @ @0@ @D@ޔ @6  & & @S6@!*@'Ho`j2 !!昔+ *@ @ "*H*o`0@O 㿈@D( V<; @ "@@O I?`''@ `$`, `$`0 @$`( ` $`4 ``8@o `T`0@j $` `H @ @@@ @  $`  $`  ?@W p@ ڠ"H t r<; l (``d  @(  ' ' R'`H @Rw@!*?Ho`j2a !!昔+ *@ @ "*H*o`&`&`` &`  (@< * &@ 8@ `@Ԕ  T`0@ϔ  ?@ڐ X @ `? "xHo`j2 @K*H*o`` +` ) !!L@O @UL`р`!Lx@ 'x'|'x `'x!72* @ 2 @L$0-`* ?@ @`?  @i ?0r` `E<g"\*` €@}ud   x!!L!Ѐ`@N @UYH "(0 `$0  !0<3 j2 H  `    € 2`0? !0<3 *0  !0<3 j2l 2*@  * @#@ &&&&+@ *@  @ # d@~!!`0""`" 0"@  &`0 &@ "@`&`0`?&`&`"@ g `H @ @@  t t <; <",` 7##   +@IH'h h'l@ @ꀢh`$` `$` @&h ` $`  `x@k 蔒`0@f $ `H   @ @  $  $ $`L(&   #&@1 @"( `@  @!(%c% &`H`&`&`& &$&( &8&`8&`4&`0@~ @~ ""8`@  "`!X `H @ @@  "@  @"@  <; <",` 7##   (``&`&` &@&`@ @&P 2@TH 0@*@&@*@!0@ $ $  ܒ@w 1&8&8 x'x` '|<g"<*` €'''x&`|&d &hl@K =  `.<g!*` €&l &p( &l 6p &t &x &| &l &p  &l 6p &D `H     @ @  &H &L  @0`H@ @!`&`4&`H&`0`&`&` 2&`L4 &`L`&<$t &@  p@<w@|ڐ @|ؐ "`@ f! "  `H @ @@  "@  "@` <; @ <",` 7#@#@   x(t``@ P$`Đ`8@`ȑH 0@*@&@*@!0@\ $ $  aP@M 1$`$`$`   @;``H@6 @"&`4&`H&`0`&`&` "`&`L &`L`$`$t $`  p@F`@|% @|# @ ` `H @  @@  wH wH <;  <",` 7##   P`H   @  @@ @   `?&&  @ `H&&  &@&`&`0&(& `  $#  @$@@( @ @ `!( @ @!($@`  ``` `  $D $L $D $L $H &`H`&`&`@{j @{h  2% P Ho`j2     @  3`* ` * @" &&&* &*  @ # *H*o`  `0""" `&`0`?&`&` `?<; :?"5  @ "( "% <;  ?򀠠?   @ ?@!!  2 02 0-2 0؀2 0$2 0ހ2 02 0뀐2 0q2 02 0L㿘`/@?@@<@ @d@ < (@@X@</@a ?@ < P@@A$*!<)<'<%<", @D @8@d#P",@d@d<c t€&p߰&0㿘0//0@ %<#<3<,0`@Dm `@8 @ccc`t ,㿘#</a@x < x@0@?@<@' @@a/ 0$a@㿘</ </</*I*`J*DHo`X< <b0`"<@ <@!p@L` "<H*/ @ԽH/ <@ِ! `㿘<!` <@ch!@,㿘<!  <@c[!@ 0 <@cS!@^㿘 !<N@#@`2N@?㿀<3 <2* bL@ <  x< <2" 2<< <#<`<2` <3#\R`<, <L#` #d#h#l@@%3@b@%S㿘<",` 8/ #@p <@㿐0  !0<3 j2k @א 20$ 40? !0<3 *㿀0  !0<3 j2O ?#6  3 "  ?0 ? @)@&x?<;  ?  ? 20'@' A "`  ?0 , /?y0 @"q2 l?<;  ? @    2]0@"R@#M@$H D 3  ?>0 . 2?70``  @-䰒 2*0<; ?& ? " 0@-}@/ @+J@,?0? !0<3 *㿘p` ? @|0  !0<3 j2y ol    *@ ?o  ' :o 0?  <",`8/ #@ @/ <",`8/ #@?<p@?"@0 . @ "0@s0? !0<3 *p `@!㿘</#$ `"#$0  !0<3 j2  <`@ai#(0`!0<3 *??㿘0  !0<3 j2  @F0? !0<3 *h ` !` `<;@  ? 2@?@`4'` `/'`'`'''`  @I  !<;  ? 2?&`2?& `?&&h  6?ꀦ`!`'<;@ @    `!?  @H 2"<; @    ?㿘 !@L=㿘<:?` @SP<.#! @ &`@`<; @  "  @2?2 02 0@NӐ@2 0@Nۋ@2 0瀐2 0@N@@Nʋ@@Tb@T\#t~#p@Tk@Te#tx#p@Tm@Tg#tr#p#xȐ@mp<$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$l$$$$$D$$$$ЂЊ`㿘I<<"`P ?""" " 㿘. /<"&@ .` 6` @"(R@"`"` "`???Є ??Є??Ɂ㿘@#  $   @ '47 `@ `#2.'- ``#*.@ɐ @* Ő  @@ - @ +N  : @N@N @   *? @㿘<#X@ɐ $    , @: ` , @ # 2`@L @L @  +  <X  0 @* @ * *㿘Z *  U .@`2㿘'</c</ #,`#,   %<Q  "      2  $(</,,    2 㿘  &@ *`@&@ &J@  @ 6@㿈0  !0<3 j2m !<w!P@2! !`&!&!! !< 82 ' #X  = <F T`*`,``,`' : 4 !  ,`,`;,`' ;* 1`'*` e'* `'*` 0' ! 8'*'* '* '+ 3<D'  '* 5`'*`!'*  '+ 5<t ''* f`'*` <'*  '+ )<D ''*'*`'a`^-`a`?* :  3* t@€X  =  S`-`*`*`*``' @' @ 0!@'!a 0!!a'  @ @ !"  8@@ @'!@ M `  I&!!a' J `,'ڒ耢 `i耢 `<#x #x `-` `,  `, V, <#1 #!a' &J `,!'耢 J :' V耢  <<#p #p` -` + )+ #x #x<# #` `-` `* `**!a' `&!&!@0?  !0<3 *0 `7a`</( 2 0㿘@<9#d@ h`@P<3!T`@!<15<#<"<3!<2` "  @  @u $#<=$#<$cd<c< @ `2` <3<@ @ @ Д@@ &"  #@ " " 㿘Ho`!<9#d@ _h`@'$#dH*/ <<:(aT0  Є@   "Є@""< <3!T> @<3<3<3#!T"!l""h㿘<1#4 g`@,g g < g ` 2* g * @ ,g@@ <,  @?  2 @ <,  (? g  ,g g ,g@&*  @l g ,g g ,g@* @]  g ,g g `,g ``㿘"H 5? 3"(1;,` <  ,``(  @ F @  @ "H?@,` (,` h@` $@@H @@@`"H?%"Hӓ,`㿘0  !0<3 j20  "H:$"H'; (,"( `< @ @  @  @ ""H@r  `@$"H0? !0<3 *2 0), Ā̠+)</+<3!l `@!"), Ā̠+)</+<3!l `@""), Ā̠ ), Ā̠!), Ā̠+)</+<3!l `@+?b&%&), Ā̠+)</+<3!l `@+?b&%&), Ā̠1), Ā̠㿘0  !0<3 j2& ` P@2`@`@a2bb2dd2hh2@ @0? !0<3 *2 0<H!d l L *`*`*`<H!d ̆ L ϊ *`*`*`*`㿘<H!d`&#<Ha` Pa``$a`0 ` @Ђ"0<Hd2(㿘#<2cP !cP<,"@cP# #  # 㿘#<2cP cP<Hhh"@cP# #  # 㿘!!<3 @  <,!<2"cP<H"!h!h" <"  " ؐ   @В@ΐX`hpx\D㿘@@@| @h 4@6^ @?] Y @h  <@Z !@`L @[@@D 4@6: @?9 5 @E  <@Y"@<( @8@5 @! 4@6 @?  @"<<<"cđ2 @0 㿘@@@  4@ <!@Y@0L@@@  <@Y"@07@@  @ܐ @Ŗ  4@@> 0@Ȓ<<<$@cđ2 :`$@@`@@@@㿘p&p@ "   !"  "" " ," & ,&  㿘ߐ & ?㿘ϐ ?``  ` ` 02` .2` .?# @2 .. 㿘 @ ?㿘 *?`` ``?*. ?*  * ?  *`    <; ?"  ""0" "`("""0"㿘X   *@& & 0&& ϒ㿐0 0  4  < @ 8!0<3 j2        `l! ;   & & 0 <* c  ` 2 2 X       `2 2 2  \     6T"@!2T"@" 2 T\"\ 2T"" T@ !! `2     t      k ("` $ H`<7#$@rh` x@& 4 8"`8 8 4"4 `"  "` `  x"`|$ x<H$ 48$ 88"`4"8 x$  | $ "  x" |##$ @<   `       x     `<z! *` €@`    &p `@*@&p `@    @  & & 0&0"c"|2 " ?  ( / ? "(0"Y8! "U""Q`"M`E`"H`@`"C0@"?bH7`":42`"5H"1@"-<%`"(D `"#0" &8` " `  4@  0* <@V"0V `  *@& 5& 0 P0"" 4&p `@5`6    @  & & 0&*@& & 0<; @"䀢  ?   @  & & 0&$@ $` $` $`  `   " ? <; @"䀢  ?   @  & & 0&@``` < * @`## # #  `  #    <; @  ?" %  @  & & 0h&%0%%%  "$`$` $`$`  @# @#  ` <; @<  ?  @  & & 0/& @ %0@ٔ `$%`%%$%   #@ #@ ` < ;   ?   @  & & 0& " &p `@'9L&p `@4 & ,c < ;   ?   @  & & 0& "J  &p ` @ E&p `@ƞ *   @``    "`" ""`  ?$ @?$ L   " @? $ L *@& && 0m&  @ ?_ '"`$ @?Ӑ$ LH`<7c$@ih` 4 8 "8 8 4"`4 `"  "` `  x"`| t$ x<H$ 48$ 88"`4"8 x$  | $ "  x" |##$& 0 *@& &&  @  & & 0&  @  & & 0 &    & & 0&& 0? !0<3 *㿘 0 0 8@  !!8!L@:  @@L @9 !L2 0@B@@B@@B@@BNj@@BË@@Bȋ@@B@@B@㿘0  !0<3 j2$ ` @Q@!X  ! `<@  0<@T" @9=  0? !0<3 *2 0ם㿘@Q㿐  '@#Ȓ 6` 6` `@(`` *    H* @.`: 5@` *    H* @ *    H* @@o8<<@S{"<@Sw#0<@Ss#pp<$@Sn#p< @Si#<#& & & 㿘6` 6` `?   `` `  < @SD"<"ȑ6` 2 ` 6` <@S5#<F F06`@ ` (`` `` `*`    H* @.`: 5@` `` `*`    H* @ *    H* @``@<0q  *   H?@@ ,`@,`<`#"@ ,` , )@@"@ ,` , )@@ "@ ,` , )@@"`7   *    H?@<2#T "`@4`4`*4`*`*1*1*1** *4`*4`***4`** @P X`& & 㿘  !! @7 㿐0  !0<3 j2 8 ő6` 2 6` 6` 6` `?       = 6`    H*  <? ;  ? + 6`  *  H <? ;  ?  @ ` *  H <? ;  ?   q` `  < @QӐ"<ׄ"ȑ6` <@Qɐ X 6`6`@ ` (`` `` `*`    H* @.`: 5@` `` `*`    H* @ *    H* @`"D` `r<0 ` *   H?@@   ,`@,`<`#"@ ,` , )@@"@ ,` , )@@ "@ ,` , )@@"`  *    H?@<2 #\ "`@  4`4`,4`, `, 1, 1, 1, ,  , 4`,4`, , , 4`,, z D ` *   H?@ `'* * H?@  `` ,`@,`<`#" ,` , )@@" ,` , )@@ " ,` , )@@" 4`4`,4`,  , 1, 1, 1, ,  , 4`,4`, , , 4`,, ڧ   *0`&  &   !! @5 0? !0<3 *2 0 㿘`<;@<  @  ? ?0P @  4` `  `4`4` ` @  `  ,`,`2:       )  ) H?    ?򀢠2?   ,  , H?    ?򀢠2?     p@0 @ j@@  . @  . "   . H? ?"  a?>!  @   .  2   X 0B@   . "   . H? ?"   #? @<* ! @!  ! 6  ! `!!<2@ خ , '<  - `2  - ` < #Д<cH @' ?<c/@@ x<  @O 0j@  `X`?#@ <2#- ` < `'< =# <H  @N4 1  7<9<H % 2#P@@'  ] - `%    @Ly `@% `ת`,``<  `< ! @NX?<<!8'cH@ @<2#"P`2"T{& ( @@  `"T@  `@ @#` @##T@  < `!@ @N`V& (``+` ` * `* 2` 8 & (<!x@ND < (! @N; (`"`` +`? ( <@N)!<  `@N"!# `& (`` `*`* 2` + * (  (* 2` 3`㿘` <2#+` `* 2` 2  ` #@* `* 2` 2  <" @M<" @Mݘ<2<H2`2`*`( * 2` "㿘@A㿘ɠ <# &# <2c& `3 3  + *  *3    d@ * * <:!T`Р"@ <9\ `&  #& ׶ А"??/!`&& 㿘נ <2# @  d3 3  *+   * 3  @* * <:!T`Р"@  "@ & А"@& &<"#<3 #T>" `@<3<3<3 T"l#!1#ah㿐 `@.2. 㿐2   `@ *`2 6 㿘B 't ` *  * ` 2<22 c** ` *`  2 "c `<#c<#!22 `**`  * 2 &! #c  #c ?&㿐 `. +* . @$'㿐2  `?*`#.+ 2 * *  @'㿘1֧`*    * ` 2<22 ** ` *` `2 6# 6* `. *` 6 " ֙  㿘6  `6 *`. < *ؐ 6  `2 `<`#c@LQ <#cؐ "&`&`㿐<3!8`     !! `20L?  !0<3 j2 `  0?ꀦ`+?֖<; @"/0 Ֆ<; @70 ؖ<; @'00? !0<3 *㿘<3!8`    !! `20H?  !0<3 j2 "< ?.0?)0<;   ;   <;   ? 20 ` 0? !0<3 *㿘 Տ,ܢ<2#4 4  `*`,   * 4 "`|ՙ㿘 v,â<2#4 4  `*`,   * 4 "`xՀ㿘<<#8ch@KO#㿘<<#8ch@KF# (<200 `*`(  * 0"`| (<200 `*`(  * 0"`x㿘!<H!x<c0@篐2 0怐2 0C77777 7(707878????????@@@@@@@㿘p`  @ U0  !0<3 j2 R X@ !X<#p@JԒ ? 8l0l    , @ "a0  ' "\0!?  <",`2 8/ #@8  @{ ?<",`2  8/ #@4?     *2`   `   "  !<0.@ ?$0. @yŐ@   "0@B0? !0<3 *p `@ 㿘p?` @0  !0<3 j2 <",`2 p8/ #@(T0p , N</ 0 p@  C" < p"`<@|w$@;0x#@??,& 8/0p@{C $`( `2"0<Ac<=<=:  a<=<<: cȐ  2$" 2  p" <   @y1  0? !0<3 *p `@dX㿘0  !0<3 j2R p  <`<j "0? !0<3 *㿘0  !0<3 j26 <@I#0`!0<3 *?㿘0  !0<3 j2 < <2#.  < P @It 0`!0<3 *㿘0  !0<3 j2 < <3 . < P @IM0`!0<3 *㿘0?  !0<3 j2 /2;0<; ?  ? 200<+?@'$ %p@r@o @j@8 @b"0@\@ .&0 ` 0? !0<3 *!Hh2? !ffff*(@ "`(H( Hh2a? !ffff*(@ "`(H( 㿘 ? ?ꀤ & A? #; " < :$& <   $ <  4   4   < @ @ <  ,  "& & 㿈0  ?!0<3 j2 8O0l    *@ "D0  & "?0 8? 42?''''    L@ž < А @`쀢 <;  : "&@͐0? !0<3 *㿘 ? ?ꀤ & 5?;& <   $<   4   4   < @ @<  ,  "& & 㿈0  ?!0<3 j2] 8O0l    *@ "D0  & "?0 8? 4 2?''''    L@5 <  @-`쀢  <; : &&@'0? !0<3 *㿘<:  @ <; @<.aܐ@R  `!<." @F ,J A@> S @9 \ @4  @㿘0  !0<3 j2   !  @,+! <@F ِ0? !0<3 *?0!0<3h2<(     /  ?0!0<3(㿘0  !0<3 j2 Ȑ 0? !0<3 *㿘0  !0<3 j2} X !X@挘?20 " 0  20`" 0? !0<3 *xl    *@   & 0  * `& `7'$?7``   "4?  `(77'``  $؀ 6 @ "   @0]  6R? 2@CI? 'P'x B' ' ' @;''T'| '͒ ' '$'(','@o'<P @ @3/@Ł* 2 <<a(0@ @Ŋ㿘T@!??  !! `20[?  !0<3 j2 F2E02 2 2 <a8@ <a@@ <aH@ڐ <a0@Ґ <ZaP@Ɛ <<@Eh!X?a@޻  ?@} 0? !0<3 *㿘0  !0<3 j2? ```@M 0@L0? !0<3 *㿘0  !0<3 j2 "?@\H0? !0<3 *㿘0  !0<3 j2 @*H 0? !0<3 *㿘0  !0<3 j2 <@Dߐ!0`!0<3 *?0!0<3h2<L 2 0(!0<3(0!0<3h2?< (#  d  ! a?0!0<3(㿐0  !0<3 j2 *  ?,0%?(0`<"@*` €          '@  @$@ 0? !0<3 *㿘0  !0<3 j2M    ? 0 ?0@U@`H\@@0? !0<3 *㿐0  !0<3 j2    ?0 ?0@K "0@ ݐ @@ 0? !0<3 *㿘0  !0<3 j2 X`!X@q0? !0<3 *㿘0  !0<3 j2 @]20l    , @  $ @2?0? !0<3 * 㿘0  !0<3 j2 @20l    , @  $ @2?0? !0<3 * 㿘0  !0<3 j2j @W20l    , @  $ @2?0? !0<3 * 㿘0  !0<3 j2? @^20l    , @  $ @2?0? !0<3 * 㿘0  !0<3 j2 @/x20l    , @  $ @2?0? !0<3 * 㿘0  !0<3 j2 @.20l    , @  $ @2?0? !0<3 * 㿐0  ' !0<3 j2 @,Đ ?c$@/ 0? !0<3 *㿐0  ' !0<3 j2  @-y??l    , @?$2?݀?? ?c$@.٘ 0? !0<3 *hX` !X<;@  ? 2>?@`5'` 0'``'''''`  @) ; '<  ?򀢠2?&`2 ?& ?&㿘0  !0<3 j2 ` (@.i0? !0<3 *㿘0  !0<3 j2 ` (@.}0? !0<3 *@/@2 0@/0@@/7@2 09@/̐@2 02 0ŀ2 0ۀ2 02 0 20q202 0 @/5@@/=@2 0@/Nj@@/ϋ@@/@@/x@2 020>2 0g2 0~2 0b2 02 0တ2 02 020$20<2 0h2 02 0逐2 02 0;2 0f2 02 02 0耐2 02 0@2 0_2 0뀐2 0 㿐0  ?!0<3 j2 4u0l+  `m  @<; '?  ? 2Z0` < !<@H!< q@ @I-Ea2@""Pa@""*a @"" v@"< }w@  @ِ a@""a@ a@  a)@a(@a@""a@ a@ a,@  a0@" 0! @ "\"#  @"" a;@@ Ԓ " @ "A"" @6 Ȓ0!@P !@ P"!@ "<"8!!@0 @7 !@ "C"8!!@7 @>0!@D "a @H a  a a"a"a a a"a "a"a ݒa" ڒa!"גa"Ԓa ђa Βa" ʒa"ǒa"ĒaU"aT aSa1 a2<@?!N?L ; ?  ? 2=0 @?%?& ?<; ?  ? 20 @ǔ??&??" ? 0@۶??Ӑ0? !0<3 *2 0z @X0 Ā㿘<@s! 㿘<!<3 `@?<@<Ȑ" 㿘<#    @T 㿘<#    @I 㿘 $?<3 Ȓ  d*@ <@70#   @/ 㿘 $?*<3 Ȓ  d*@ <@0#   @    @ : ` p<3 ȑ*@& d㿘 $?<3 Ȓ  d*@ <@ 0# @ 㿘 $?<3 Ȓ  d*@ <@є 0# @ʚ 㿘`$?<3 `d *@ <@0#  @ 㿘`$?<3 `d *@ <@0#  @ 㿘<#   @ 㿘<3 Ȓ  d*@ <@x0#  @p  !H(0㿘  </` @~! ? R<3< (a'<3 ,@ @h @@? , %   㿘<"4  /<3- +< *@@@F@B 2@& db0@V㿘  '<3 #<,@bH@@  㿘<3 ` <"4. @`*@㿘<3 Ȁ` `<H+   ` : #0< )<H+ #?` "<3   * .@<3 (  ,@@"  @  ,@#<3`( @@#@?"@#@=J <@; #8㿘<3 `k<3 Ho`<3j2 <I`d"`d# # # # # <3 Ȯ <3` *  @*<3 (  ,  $?@g$`$?$`@ <I |   2``| `@<I  *` ``@  @*`*`0㿘##<3 `<I`d,`  "`d    @  $㿘##<3 `<3`(@ @ @'<3! # ` <3a< "<32 `j2y  <3! !*  " *`@  "`*<,` p  `W"2   <@</ "@L @  %<</ `J ` /`? @.C? ! !! <5  <5<5`"aa "a   " `" "`p"@L @ڞ!@?"@2 0񀐠2 0㿘<3 `e<3 Ho`<3 j2 <Ib:@:`:`ր<3` *  ;<3@*<I"| # ( *`*  (@ У@`@( <I" 2`" `@$ <I"8 `b8  @$ `*`0㿘<Ib  *b    @  8,Ā<IX0㿘`%< 2!<Ho`!<3 l2 <I"bX<#    U ,`<#@;g<@9' 㿘ڀa*  Ђ?` вE<I+`! ``" ``""  <3 :` < ` *  **    ֪<+` p  `D"`2  `8   @-  ? ! !!<3`j23    <5<5`"aa "a   "<5 `" " *<!`p"@2 0߀2 0g2 0ȝ㿘@׃  @<  L "" L  `L, "   " `     <#@:   7o`L, "" "     0"  0㿘㿘@<@: 8<@: P<@: p<@: <@: <c`"<<@@: <@: u@׌㿘o8<<@:w!fp@:s!8fp<$@:n!fp< @:i!<!@@ D "6    P0 P 6     6  ?  P @) ''H'㿐2 `&p` ` <3 <<*ሒb @   2p <. j @=`<U@kE O`@2`!G`"@ " #@  @`X*  (`,?`,&`"@ @&`,X2  "X`@ @`\ "`\ `   @h ^E @R0d @I `%' @   <| !t@ <|#@*  <}"@ < 쀢@ & @& D& & 6& ` $"$"@ɐ 0, `   @%$  @<!@9g"@O  @ $"$" @`" 㿘`p  @ ;<    ? 2 0Z @0 " @ @ >@ 270 &$@sԎ`< @  @*@Ц02 @ 2  $@VԎ`< @  @*@Ц0 @  p@j@@[0㿘`8 0 pfp @o@i J @0 !C"@ " #@  `X*  ( ,? ,$ "@ $ ,X2  "X @ `\ "`\   @fʖ  4 @ 8 @ $b$b @ '`` ` @$$`֐ @<!@8Lb@N  @ܞ $b$b@ fp @@in J @1 !C p "@ " #@  `X*  ( ,? ,$ "@ $ ,X3  "X @ `\ "`\   @f=  2 @瀞k05 @wj $b$b @ 0%`` ` @$$`ؐ @^Y<!@7b@M  @QT $b$b@ 㿘 8 00fp @PD@hے K @0 !D"@ " #@  `X*  ( ,? ,$ "@ $ ,X2  "X @ `\ "`\    @e 4 @8 @ $b$b @ '`` ` @#$`֐ @ɞ<!@7,b@Me  @漞 $b$b@e fp @Þ@hN K @1 !D0 "@ " #@  `X*  ( ,? ,$ "@ $ ,X3  "X @ `\ "`\    @e 2 @_05 @V $b$b @ 0%`` ` @"$`ؐ @=<!@6b@Lِ  @0 $b$b@ِ 㿘 H 8 0@&p @.r@g K @0 !D"@ " #@  `X*  ( ,? ,& "@ & ,X2  "X @ `\ "`\    @d 4 @˞.8 @, $"$" @a ' `   @"d$ ֐ @姞<!@6 "@LC  @嚞 $"$"@C &p `@塞 @g, K` @1 !D 0 "@ " #@  `X*  ( ,? ,& "@ & ,X3  "X @ `\ "`\ `   `@c 2 @=05` @4 $"$" @Ԕ 0% ` `  @!$ ؐ @<!@5~"@K  @ $"$"@ 㿘fp @@f S @2` !K0 "@ " #@  `X*  ( ,? ,$ "@ $ ,X2  "X @ `\ "`\  `    @cc 2 @䦞Y05 @䝞X $b$b @= 0%`` ` @!A$`ؐ @䄞G<!@4b@K   @wB $b$b@  @#8@@#%@@#@@#M@@# R@@#@@",@@".@@"@@@"E@@"M@@"Ր@@"͐@@"Ő@@"@@"@@"@@"@@"@@"@@"@@"b@@"}c@@"ut@@"my@@"p@@"]΋@@"UЋ@@"M@@"E@@"H@@"54@@"-5@@"%F@@"K@@" V@@" @@"@@!@@!@㿘1<4 @ޅ㿘!<8 @~`@~ސ@~㿘<@3~!@3 <=!<*`@3v!<<c<<*А *     <+<-</<3<5<1<<7<(  *5  (!$(  (@ :     : @   (" і@3#@3 b @30@3H@3b`# @3x,`< @3 "@T@)㿘<<D ` # #<'<<!$2 * В@*` " "@K $0 $<<<=*`Ą <<<Ac(( " " "  6"   */ ( " 8@  8" @   `"` :ז  ( ( " " 㿘` @"<@#@ϔ."@fp<'#@&@'''p'T@}Ȓ'p @}8j'_? " @ @'Ԁ'خ8'ܺ"@@} ܒ% @  @9831<@}@}T@}"!$@} @}<<#Ē#2` <<*cА *   `& $@. $@$$ Ҡ @ @  ؐ@  '䀥@ @}P ?p@}I㿘 @   <@1#  0<Ibh` "`bh` "`<3a $ $ $ $ $  $"a <3<3!"@"!㿘<3* a@ <Ih&p"hĘ<3!@ #H`</ Pj2, <:T`"T*㿘<3!.  " &p `}"`` x<I`s<I"\  <I` <I<Ibd  "bd<I"`"\""d"d d#<I <@1]#bh`  "`"d 2 @<@1Q bh`  P"`@|@| 4bh@| /bh@| @| @|@|bh @" @| @|}@|z bh@_f bh`   "` bh "@T  <I"h  `" $"$" @>  㿘<3a 6 K $    @t @b    G      @ab@֒  㿘 <` !l!d@P?"@"`&& &* &<*  @ # !!@0 (%<3 ##<3Ho`j2- @*H*o`@Րa {L2 0ϝ@Ґ@@@2 0Κ@ "@ 088(@ @  "+"0*6? @ @` @` "0"` @   @ "0"` 㿘<:! "  4   8 "   2 4 <2 ? ?(<J2`(?"@<2 ? ?(<J2`(?"@<2 ? ?(<J2`(?"@<2 ? ?(@<*<2 ? ?(@<*<2 ? ?(@<*< ??* << ??* << ??* <2 <㬅( 2  <:  2  <"2  2  2 *  㿘6`<c* @@ 6`@z`㿘6`<c* @@ 6`@z`㿘6`<c* @@ 6`@z`㿘<@ :&@ &@2`@z`㿘<@ :&@ &@2`@z}`㿘<@ :&@ &@2`@zp`㿘<&@2`@zg`㿘<&@2`@z^`㿘<&@2`@zU`㿘&p`$?` @zG &p<$㸑* @z?@z=&p㿘6` < `?<#j@2 } @ 7   <<<<*` !* !(!<<<<*` !* &  " Ж& *` *  *  *  : * @ ", @y.`O @! "!@z`"<$@2 * <<@Г*` @yА?#$ l2 ! $ " "<@ `,@y.`@ ?#" `", ` <@y .` @.F  @y<"0 <<(cЅ(<j2 ` 2"` 2`  ("`  *㿘6`< `?<#j@2 @ 7   <<<<*` !* !(!<<<<*` !* &  " Ж& *` *  *  *  : * @ ", @y#.`O @[ "!@ش`"<$@2 * <<@Г*` @y ?#$ l2g $ " "<@ `,@x.`@ ?#" `", ` <@xݐ .` @-! @xӐ<"0 <<(cЅ(<j2) ` 2 "`"`  ("`   *㿘<#j@2 @ (   `<<2*@* @$*@ &  "<<#Ж& *` *  *  *   : * @ " -@ N @ I<. @xo  ,@ $,@@M,@@@D,@@@;,, @֐@0@<& 2` *`<< Б* @x9 $ m@2 @$  % " -@㿘H/`<7c$@@h` <H 4 '< &p " 4@x" 42&pH/`$@#h` j@2` @ ,6 . #<<<#В$ *` *  *  *  :  * @"@ "$ "( "," @w   <<*z㿘~@ 0z 0  @ `    /  /<z  㿘<!(<3 `@,.㿘&p $N"<3aj2 <   &p <c" "$`$ ""` $$$$ <##p "<@)!P@wP @wN  "` "$`$ "$` " $ $ $$!*&p<c$ * @w4&p" $Ң㿘<3aj2 <    <c" "$`$ ""` & $%$ <##p "<@)m!P@w @v  ?" "@$`$ "$` " $ $ & $*@v< $*  @v@vp" $Ң㿘<I"p0` 6`* @vΐ@v̒6  .  @v@v@v㿘<I"p6 ` * @v@v<8`@v @v@v㿘 @ے 㿘@ 㿘<  @"&p@ &p`$?` @  &p<$㸑* @vz@ &p㿘<3aj2 <    <c" "$`$ ""` & $%$ <##p "<@(!P@vH @vF  ?" "@$`$ "$` " $ $ & $* <2`* < $@ #*2` `z@ , 0p" $Ң㿐΂?<# ЂA̐ ` `2` @ '` @ 㿘mH/`"ނ $Ң?  @ `    #`cbmlkji ?"ޢ 㿘AH/`"‚ $Ң?@  @ `   @ ?#1@B B/B#B"B-B,B+B*@2@@*@"¢ 㿘 H/`"ނ $Ңp  @ `    o     ?"ޢ  0  @ `    / 㿘$`<I℄  $#"ʂҢ`ʢ<I  ?? @  $" b"@ʂ֢@jʢ<I  p$"ʀР@`ʠ<I 㿘0~@㿘6`<#*` @ 6``z@ 㿘<  @p@ &p`$?` @t &p<$㸑* @t@t&p㿘<  @"&p@t&p`$?` @t֐ &p<$㸑* @tΐ@t&p㿘<  @p  @ `    o    ?&p`$?` @t &p<$㸑* @t@t&p㿘&p $T<3aj2 <   &p <c" "$`$ ""` $$#$ <##p "<@&Ր!P@th @tf  "` "$`$ "$` " $ $ $$!*&p<` 2`* <`$@ #*2` `z@ &p" $Ң㿘<3aj2 <    <c" "$`$ ""` & $$$ <##p "<@&{!P@t @t   ?" "@$`$ "$` " $ $ & $* <2`* < $@ #*2` `z@hp  $"Ң㿐<I""<#\< < 8#`@cx㿘 $?5   @ :  )@s<c $< * @s`@s<3h22 $< H*@  <@ ` @  "#@ `# ""`(?& $㿘  w H` 0 fp `  x B" ;< #@@ "5   /`4 *` "#  4 `"  4 @" @  2  @sE@@sA @s> $* À`6` *` 6` ` 6`  @s @@@s @s㿘 $??   @ :  3@r< 2<#* < $@ #*2` `z@m@r<3h2u $< H*@  <@ ` @  "#@ `# ""`(?& $㿘6# AA` @㿘(# AA` @㿘# AA` @㿘    # A` @# A` @ $`<I℄ ℄$`<I  $`<I $`<I 㿘<#@3 j2 ' ?#  2 `$`$""   $ @} ` ` 02 <#*`` >`@4j2 䀢)   2  `$`$""   $ @}s ` `䐕  ` : @02 <#*㿘<#   @qݚ 2 <㬅( <J2 ("?<  @< <"<  `?㿘@q   @  `?㿘@q <*`?  @  `?㿘@q   @ 2` *` 㿘6``㿘!6` `㿘<6``㿘D6` `㿘[6``㿘_6` `<j2 ? 7   <<<<((!(<<<<(("  c #Вc"(((( `8(  "`c(<j2 ? (   <<2((("  "c<<Вc"(((( ` 8(  "` #(<"0 <<(cЅ(<j2h ` 2"` 2`  ("`  *2 @0~2 0ڀ2 02 @082 02 0Ҁ2 @0逐2 @0X2 @02 0 2 0X2 0 2 0耐2 0?20ɀ202 02 0M2 02 0Y2 0㿘@pU 㿘0@@pK&p@ `*`" ?㿘@p7 `.`& ?㿘`  .` @"p`  @p$0@ " `0㿘< h<3`   <!L`     &2 * o pH<H c @| @v`2<@ې"@ "<3@ʐ p!(`@p@op@o@o@o@o@o`@o2   @o2   $&0 @o  0@$0 0<3!(`  0@N$0 @o|" 㿘o/2 ``"o"1!2o((p * ( 4 *   ?.   "@  ?2  ` 22 ?*   @   2  `@* Ą< <#@!~  : *` 2  *  ! ! @n$?, 2  ? `  4 (` +@P(, "@ 㿘Ho`(l2 U,`㿘H/`j2w ` .`6 & ?* 㿘H/`h2V /6 0 @ 3(` .@ 3( 㿘Ho`(h2("(+ / 0 6  6 (` +@Ş  6 `+((`㿘op9<H  @zb @ͻ`2p<@  @@n@n@n @n @n <`h&0 2 * @m2  ?  ("@ 2  ͐ @m@m㿘o : "H/`j2 `?* @.   2*   .  "@ `?2 `? ?2@ 2@?*     2  `?* Ć<`` `< H@  : *` 2  ? *  $ $ "* ? @ 2(` *@Ş?- 㿘!4 @mIp2 h ?,  o"@2 0o2 02020Ӏ2 0T    <#<`<@B`    <`<<@ @@@@@@    <`<<*o * " * €Œ‚ƒ„… $"ցС$΁`""  #@"֡  $   <`<"*oԂĢdƒ@` "p "@BB B BBBoBB#"ԡ@`<`<*/ $ʁ` `"0"  /#@$@`" $ʀ@#Ҡ@`ʠ@" $ʀ@?֠@ @ b@`"@ @ *@`ʠ@ " $*oʀ@֠@@`ʠ@<"<" "<2 *` 0(0  @*` *@ęA  *``<2 *` 0  p  ĺ@ĺ@    $@`" $ʀ@#Ҡ@`ʠ@" $ʀ@?֠@ @ b@`"@ @ *@`ʠ@ " $ʀ@ p֠@@`ʠ@<3h,@$@`(,@2,0<3h,@ " $ʀ@#Ҡ@`ʠ@(,@2,0<3h,@" $ʀ@?֠@ @ b@`"@ @ *@`ʠ@(,@2,0<3h,@ "  $ʀ@ p֠@@`ʠ@(,@2,0  $   @`$@` " $*oʀ@֠@@`ʠ@ `: `: `: `: `8: 8`0: 0`(: (` : `X: X`P: P`H: H`@: @`x: x`p: p`h: h``: ``: `: `: `: `: `: `: `: `: `: `: `: `: `: `: `: `!a<"<bT<h@`" @ @ A@`$@` " $*o$@`  㿘!<K ( <@t  (㿘<  <K , `?㿘< <3   @<KH/`<aPj@2A @0&"0*@  <K @ K #x'@'< <K4b   4b 4b <K4b"("`,H/ fk2 8 ?$f$f ff* *@ @ $`+H*/ 'ؒ''' @ +<9<K< aP)<31<K $@Ho`cD@kh` "'%$D`!0 $@@ H`cD@Lh` `2"`$D!0 # $H/`m2 !0%!0-    $  €"` 2  $@  #`   ?  <      !?`@zffff* *  @ p$`㿐<K $''H`<9#D@h` $ '# $$D)<K  !Ґ 0@ ~?H`D@ͯh` `2"`$D㿘<!P є& 2 @02 0瀐2 0[ߌߌߌߌߌߌߌLLߌLL㿘&&&&& &&&&`&&#<K1<@@j`@!Ԅ @͆ 2@& @2   ?㿘   @  !8  2  ` L -  "'6` 2 " 6` $@! @Ԕ <K`@@j<aԄ @3@  2 6`&@&`&`&`  ?2`* ` * *# 昔+ 搐*@ @  "  <@U ! #2`( `0  挀 * (   0      㿘 @?ꀦ` ?`". ` 4* ?"' 2ll@"  @ "  @ " T  !! ` H/`j2  ?,@ 0` *<"@*` € 2@ * &L&* *@   *@# * *@ @ &U m <?2*  2@ `a?C2!Ԥ!Ԁ` `<3!4:`@ <K`@@h͒  $Ԅ @"`"&` """ `"2 " 2"" "@¡  ?` ? ??2*   +@  # @ 2 <7# &j@2] @$ <3 *@,@   @㿘H`k@29 @` ?+@'?* * `@ ""@ 2*`  * *# * *@ @ &+@Ɣ㿘B? ?H/`<7c$@Nh` <H 4    d2  4 "` 42 dH/`$@-h` `2 㿘F? ?H/`<7c$@h` <H 4    p " 4 l2  4O "` 42 pH/`$@h` `2 㿘dLE  H/`<7c$@ʶh` <H4   `   ? 42`H/`$@ʔh`  E?C ;Ho`<7$@mh``> <* c   ?`2 H/`$@Nh` 㿘@ 㿘 㿘ʒ@ 㿘 @ 㿘@ Ho`<7$@h``>  <* c  "?`2? V H/`$@h`  ` 'x ' '''|"  < L      @F! xx' x !@O 㿈?ꀦ`o<;@  ?@P    @!*@'Ho`j25 ''    ?2?     @& &    + *&& !!昔+ 搐*@ @ "+@H*/  42$<0 . Ho`j2 ''*H*o`#;<?@ǔ    " 㿐`8?Ho`j2  @  @ @ *H*o`?<;  @NJ    " 9 <; @s  ϰ?@!*@'  8 &  8& < @V    ?沐!@耢 ?H/ j@2@ @hG o'`'d  @   &&&&* *@ @ # *H*o`cQ" c&%b@b. @*`@*`@耢  쀢     !@ȐHo`j2 `!d!昔+ 搐*@ @ "*H*o` `<@@Ƭ   ?`?? @Wx'x'|'`'7x<; x@ƃ   D? 4A??2'x<?Ho`<7$@Ǻh``>  <* c  `"?``2``? xH/`$@ǚh` 㿘? ?`  ?H/ j@2- @. * ?쀦   &&& & &&`X@@# `"`"` " `*@ "`" "  C?퀢  > &?6* 2@ `6`#<K!<`"@  &@!@d`@!Ԅ @K@`2`6*`  * *# 攄昔+ 搐*@ @ "(H*/  㿈` ''    @@ @  '쀦 6`<; ?  ? = 8  3  .?  @@ !?ꀊ  ?!!` <;@ ?@E   " 㿐`^<;@  ?@.    a?" 'Ho`j2+  '   ??  "* "!昔+ 搐*@ @ "+@H*/  2 <  #;'<?@ϔ    " 㿐Ho`j2  @'*H*o`?<;   @Ğ    " Hh2?  ffff*(@ "`(H( h $''*Ȁ ȁ㿘Ho`<7$@Şh``> <* c   ?`2  H/`#$@h` &&&* &(@ @ " 2 02 @02 @0€2 0ƀ2 02 0J2 @02 02 @0΀2 0Ѐ2 0+20X$P㿘㿘<3 (;<(c0 0  <3 Ѐ z<3Ȑ H/`7<7 h2 4 (<.1<3c!.`.P<3  @H <3<Ж4(`.`0   0` 6 "  耦 "` (" &pfp"  `"`` 耠 &`("`&`@Å(``  '` ( 㿘Ho`<7# k2 & < <H  <<9& @" <& <"@`"+`E0+`㿘ѐ㿘H/`<9#@j@2 @ J<K`D<9#< "@ 1 <8 `*`)#<#<82` ` "8#<82` `!4#<82` ` 02`<8#8#8*` <7*`#,@@ &@" "@& c@* 0<"@c@㿘H`1<9#@h2 1& <KD<9<` 1 <8()<<80 8<80 4<800 0<888(<7(,&  &#@(㿘H`1<9#@h2 ` &@   &&@(㿀# @< %<3<"(@<"'''''@#$ `&  㿘 <3<3 <a*@ *   & $㿐'<<3L #<(<3 `ȓ*`ሔb    <0 <3 *<:<:aXTf<c,  H/ <7c j2 H #<Hw    <9 $ $<?@""@"`<$<$@$, <a<3`*`< <`& $ 2< "#耢 ("pp@" $<  < 2$   $$$( *H*o`}<5  "@2`$  "@H 0*@$*@"8  @^4<3 p d* @<"dT<3 `</+`!l@ H9P 9#@ `8  <3!<3 `<*`! *  $$0 <3 j2 c 0 *H*o`H/`<7c$@h` `4`  :  "4 2H/`#$@h` Ho` j2  <  ?$ " #耢`  ("``@ ڦ@.<Ho`<!Pj2 L"L*` g  €"` 2 \ `@$<" @"<$<`@"`@$@|"<@"` 㿘 F?H/`<9cD@\h`    `  @  `D  "  쀦H/`D@2h` 㿘  @6  #㿐'' $@H`<9#D@h`   '& $#D  $@Ho n * !&  &` $@H`#D@h` `2"`$#D㿐'' $@H`<9#D@h` '$$Da $@Ho l . !&  $`  `  @? ڀ " $@H`D@lh` `2"`$D㿘Hoh(&   ``?  @A㿐 !'H`<9#D@$h``?'&$DH/ @ h` `2"`$D㿐 !'H`<9#D@h``?'&$DYH/ @h` `2"`$D㿐 !'H`<9#D@h``?'&$D]H/ @h` `2"`$D㿐 !'H`<9#D@lh``?'&$DސH/ @Sh` `2"`$D㿘㿘<3D $Ho`<!Pj2s D"D*`    €"` 2 㿘<3H $Ho`<!Pj2M H"H*`    €"` 2 㿘 H`1<7#$@h`<H4" h"h24h4H`#$@h`㿘<3R!`<3h> %<3 "hT"h @$T<3!P`?<#L*` €T   2$aP0 .$aP!<T#@a '<3# <$#$aP@"<3!<#T @a <3# `<$#$aP@Ԑ" <3 $aPT 0"$aP<3!XT  <3a\ :4 <3 * #!X"ax  <3a\ :4" <3*#!X"ax <:a8  x "a8T<: 0# <:#!,"4$T<3<:t0@axax : "@#ax: #axax6: : :  ": #ax㿘<3<3  <3@4&a 6&aa &<<3<<3a9<3x3?!p& '!p 8(&'!p&0 >. &'!p&㿘!<? #А"?@ ?/a "#`$#㿘/  @!d"@"  Ԓ@@& & Ԓ d@ѐ"h @ d  d ;  d@"l  1      & &&     @  && 㿘㿐H/ <9cd@Qh`<9#\ "#\I<9#` z<9cX" /"cX!V"cX%<9LL`(`#@, +`* "@+#@ *`* +`*(@* #@ *`+  @#*@ *2 $L2 2` $`$`Q%cdH*/  <9"cdH*/ <9H < "؀ 3<35<9+<9H " a@@ *`@"H?`HHHo`@j2 ac<@ @'<81<88' -<K_<a<7#,` * @`@<8#b8<8#a4<8#`0#< c< "D @  2 2 2   28* *  #" "`# *`"   ? @ 8`` 88 *` 1%D<9#@ #<8  `  "@" ## ,H*/  H/ l2 c8*  2 8%Dc< ` %c<E$8#<8b8#<8a4#<8<7`0#,#<' Dc<!"  2 2  2   28*  *  #" "#  ac<@8@*H*o`㿘3<35<9a\&a&\Ho`</Pn2 7<:T&T.`@<9` `<3DH/`n2T&T. x'''' @%4䀢` 㿘`㿘`t``t㿘㿘㿘㿘㿘  T  !  ? (8 (  $ (8 (! 㿐?ꀦ <; ?@    H/ <7c$@h`<7 j2f  >  <* c ` ``2` M?`` F? cB?ꀠ`?`?@<  ?T @ !! `+ "@! T@ !! ` #   < #  @<H"@" <`# @`<"`<# <" @ ! *c$@h`H*/ 㿘`㿘Y?㿘 ;?H`1<7#$@bh`?`>`<(`22H`#$@Ch`㿐`Q?ꀦ &bH/`<7c$@ h`   >  <* c ` ``2` ( 'H/`$@h` <;@ @@     ?H/`$@h` ?㿘H<7 n22 ! !@<H<& @&`< <@ @ @&`<.H( 㿘 ? $ c0 㿘 ? $ 0 㿐!''<;@ @     ? 㿐<; @     y?沐!@  m?% !Q #@ #@c@8#??"T #??L  H Q"&% #bb@h. @*`@*`@       ! $`"#?@ d* "*"@ *`@*`@*`'@ d'<@@    ?? h<#b@ @ Y@` @ 8 f)<ff+<-<2   f)<ff+<-<<9ch*@ 3@ @<@ .# @2<<@ (#(fb@ ##8f`` `x`@ "`y@`#@@ "@`| "< `<@ #P`@ #X` "< `<@#``@#h` "< `<@#p@#x@@`c @ @f` 1<`@ڐ#@`2`@Ԑ㿘 @66(@(@6@6 ``7 (@ 0`6 (@ 02`` ``0`W(/@㿘<@#<@#Ho`<7#$@h``<H 4 <3!  ":  42 H/`$@h` 㿘@< !d!l@<I"h  !h@20ǀ2 0:2 @0i20ʀ20*2 02 02 0တ2 0 2 02 02 0߀2 0v20202 020ɝ㿘<9#  %<@ `H@  ` <9 ?*   x2?  㿘 < X@ے0 <9#.  z`< p@Β㿘"d ) &"d @o!<9cj2e    :  2# ` "` <  "@T#*㿘!<92  j@2B @<K  H,!   ` `  @ #,@ 2;&"d!<!@SÒ  3?!!" "l@2 @, H! `     @ @TP #ٔH " "` ""  #*&"d 㿘1<9`#h2<9Ж1?@ Є!,#9<9<9܀@e '#ܱH/`<7$@h` ;<H``4`@85<97<9?!, ``Ѐ `d`l ܄&Ѐ2#'#܀4'#`dЀ܀4'#`lЀ܀4'#`4@2``H`#$@Gh`(Ё㿘<a@S  p@ t@R!& & & `& & & & & && d㿘 (t# @&H㿘  @2 @9ϐ@/<a@Sx㿘l $ @0|<cت &fl@R  t? !$$$$$$$ $ $$@ 2U  :@@4 , < . @@@@  `,` ``* @ <` @`  $@G 2%* ` @``"`  "`  @&fl  @{@xc@R㿈?'''` ?@Q1! 0@&p `@{0  !0<3 j2 d?` @ @ :  T @B<9#Ĵa  <9#j2k <9Ԁ`@"*`0<3$"!"`: `` ` @ `"H`"`` ` @H `"?\ * @ + $\$$ `@ @$$`$$x$$$<$@$t$|$$$$$$$$$$$$$$$p$h$$$$$$<3 t(  $(" " ,<3!?$0$$t$x? 2 h@%  @R  $h?!"@hh`" h``"h@ "@h" h` `"h@ "@h " R @s &@Rv  $ ?*&!"@& @ ` 2 p`@T$$$$$$p@P   ? $p$$$$$$f@- 2% p@Op`d7#<c?@Pݒ  "bp@$`$ `$ ` $ `$ `$ `$ `$ ` $ `$$ $`($ (`,$ ,`0 $ 0`4 @$ 44 $  % $  0"p  "  h"`  "` $ `  "`$$` ` $ $p@-z 2@ ( " @`"@@@$ %@  ` `<   @7Xp@O    @ $p s w  $$$P$$T: !` C$H/ <7c$@~h`<H$48$88"`4"8x$ | $" x" |`:` <* c  $ "`" $ &#c$H*/ $<$@<9c̐ "c0? !0<3 *p `@AM K @K~0Bp$p@M@6@`"H`` ` @2 `"H`<9`` ` @!H `"<9cj@2S @<9""*@d @N02 02 @02 @0߀20@n@2 0p2 0 @~y@~@2 @0㿘 `    `@ ` " @*!X ! `  `@ ` "  `` <ѐ!@ @0  㿘<: | @* @  2 <@!8  2?ꀠ<:?|" `| ?`| "`|<:| | ` "``?㿘0  !0<3 j2< ?/X *?X `` ` @ ` "! !X`    `@ ` "0? !0<3 *2 0㿘!<K 'H'L'P'T'XH@<@/!h<3a<@(!0<3 <<*ሒb @   <@!0@sK@3<:<: 5<1   `  2``$ <@!`*`" *  * ܐ#??  <v"`p<@!Ԁ @zQQKMMPPXPQ㿐 ` <Ґ"ē*` €`?ꀦ <;@ :? <: `M <: 'H`<9#D@+h`  '# $#D !  2>О!H`#D@h` `2"`$#D F H/ <:`j2M  5 2<M Ȣc <:` @ `#`#+H*/ .@`H/ k2   ` *H*o` `?ꀦ <;@ :? H/ <:`k@2 @   <:`82"`<:<:  7   2#<M `Ȱ @,H*/ +@H/ l2 ?   ۖ#  *H*o`x u&@.@ `0kHo`<: j2 <:("`Ho`<: j2u <:<:`Ho`<: j2f <:<:`"*H*o`0( %?<: &Ho`<: j2C <:"`*H*o` ?㿘 T@ !! `?6㿘'H'L'P'T'XH`#<:`j2 !<L ː@uHf#<:L` L <2 ?L  / 74?L  >"  ? <,<: ` > 0, ,  ?,` !3<:<M Ȇc<:<:<:` +#`   # L` "   ``L`  <: $` " `(``(`2` ` ,` L`*<: 톒 !㿘@Ho`<: j@2~ @<:  "  (  ( 2 *`㿘Ho`<: j@2V @<:  "  (  " ( ( 2 *`㿈<: ` V " &6 " € <  6 %`<"X @ "8    @J 2$V "` @2`6  6 "  € 2   6 ` 6 " 6  `L Ґ |Ho`<: j@2 @ <:`2`(& ("& ("`( T<:`<:#  I <M<: Ȯ` @,@ ?L@`  ? .,@ O耢 <2 O逢 / 逢 74 Oꀢ >2 К? <: - :`@ ?   ?L@` "  *@*` H`<: h2^<:ऀ 2(`(  "( 2( ( ( 㿘  l  @` l 2 02 0ۀ2 @0 2 0F2 0x2 02 02 02 0􀐠2 @0}2 @02 @0#20<: @$@@ ""@<:ༀ @`  `?? `!`"``  2 `2  ` "d d"! `? 㿘s?ꠖ   8   (" H/`<7$@h` <H`4 ` 9 #  "-4@ @ T !! `  " (&T !! `2& 4͐H/`#$@h`  㿘`?<?H/`<7c$@rh` <H 4   ? " 4 4 4H/`$@Rh` 㾘T@ !! `?wа?"2̰? !i@ D!@!@?0  !0<3 j2 3{!#=<: H"j!0(l#Ԁ"b<0!g"<:%<:0"܀"9<:0 3   2<  2<d"i r0<: m"`k"  <3   2<  2<F#3@}  <3   2<  2<.# b@e ; ?@(  <:0? !0<3 *.? / 5  2<  2<#0 0? !0<3 * ?0? !0<3 * 㿘<: `<: #     2Ր 0  ( * ?2 "1T@ ! >?1*`?0"1 "1  "1 T@ ! "11 1?+ ?022 1  1 \ (!\ T@ ! * 11 1  10@"1 @2 ?11   \(!\ 㿘. ?#6 *T  !! `?*2 0  !0<3 j2} .` ?2`#@$ "1 "1 "1T  !! `"01 1? !0<3 *V?*?2`#22@@1@1\ *@!\@"0 170? !0<3 *<3!8`*     ` !\!T 2!T  \!T㿘0  !0<3 j2 T  !! `. 2 1112  "1201 1? !0<3 *F? \*@!\"010? !0<3 *<3!8`* `    ` !\!T 2!T  \!T㿘T  !! `<. ?#2@".`@" .`@".`@2?.`?2`#@".@" .@".@2w?.?2`#@"0@" 0@" 0@"0b?0  !0<3 j24 ?#2@.`1$.`2 @" .@ \*@!\11.?2`#@210? !0<3 *<3!8`* `` `  ` `` `!\!T` 2!T`  \!T<; <2?  @ ?2@  ?2T@ ! <* ?3 "*`" *`"*` 2F?*`?0"*" *"* 23?*?0? ? ? ???3  21*`0 " * \(!\1 1*?021  <; <2?  @ ?2@  ? 20!0<3h2+* 0"1 "1T ! "1  \(!\0!0<3(<38` `T!T \T!T * 2  "1   "1 T@ ! " 1   \(!\ 㿘 <3<; @j    ?<3! "``" `h?H`<7#$@h`?: <(` 22x"lt ll%?\?p?@ <H4d 24ll""d4 2d0"d H`#$@Sh`  7dH`<7#$@1h`:` <( ?` 22dH`$@h`d 7lH`<7#$@h`:` <( ?` 22lH`$@h`?H`<7#$@h`<H`4@" ``d``4@ 2`d` !d!p!l!!hH`#$@h` 㿘 &??ꔄ  <;@ @"  ?㿘T @ !! ` ?? <;@  @ 2?! *  2 " @`  * 2 " @`  㿘<:   @E<; @<.a@! ! 2?` @㿘T@ !! ``@-?+?<:` @<. "` ?<;    @x ` <.!ܐ A*  @מ㿘`,?<:` @ݞ<." @y 4  <; @ @B 2? @㿘T@ !! ``@-?+?<:` @<. #!` ?<;    @ ` <.!ܐ!E*  @gw㿘 (<?;@  . bh @     ?㿐 8B?<;@ @ϔ    1? 􀢠. (?"h@4T T@@ !! `  @  ? $"?" "P@O H&`2K  @* d' @p d* @*`"@*`@ ԓ*`'@ d' @a d* @*`"@*`!@!*`'%! ؒ d@' d@M* @*`"@*` ܒ@*`' d@' d@=* @*`"@*`!@!*`'!''1'ؒ d Р@ߐ' d@%* @*`"@*`@ ܓ*` ' d@͐' d@* @*`"@*`@!*`!!'!!'!  ''<; @  H  H  ?㿘` g?h !x    `@? `?4?!T`&  0  `(*`!`? 2 02 0~2 02 0ǀ20Н@@@А5@Ӑ>@W@Ðm@Ⱀ@㿐0  !0<3 j2S T@@ !! `P?< < !? @K 2<?; ?@ /4?$ "?@Kk ``H$@ ?@| ?@; "?@ے H!<:! H H& & && @.`@KH $!@KC 0? !0<3 *H0?  !0<3 j2 T@@ !! `"0< < !? @KH 2<?; ?@ /4?$@ "?@J `c@ 2<Y?;@  @ ?2K?Ā L<w#hB?@ H<@ @@ H  H +?` ?@ <Y#!``H @ @ (`<I  "`` @*<* @ <9 H``"`,`$ <*` * @ <% x`,` @ <@ @< ߐ`0` @ <@ @<  ѐ`4`8@ `@ <@ <"@ "`<!?<!8@ G(#`D  <@ <ڐ!`# <  ? @Jb ?< ?@`/4?% "?@J  @u<@ <!e` ? `H< @ @  Q? `$``$ $$`(<:`<A<<:! `" "   o4( ""(`"`  @I @I `!`, @$` $`€  ``$` ?$`?` @`   ?$`<!@I @y H@I 0? !0<3 *㿐0  ?!0<3 j26 T@@ !! ``"[<:<@ <  ? @I 2<?; @ ?@ /4?$ "?@IF &0?@Y? @I8 r0@I4  ( k? G  D     @ :  2T0@C N <:a ̦ 5  ( ,   ` 2( G  D   2     :  2  `(  $ @   ̀2 (`2<:̀    ?$   2  0? !0<3 *㿘<:<:! `̀@    );@` (  <`@j  ``@&@<; ?&  ? ?``̤@';" <`@k`@<?&`??㿘<: ̀2 g?ꀊ A " <;  &2 0? $ +;  $`@6 (  <@@   @&  <; ?& %?# !? #;,*  $`@`   <?&`??㿘<: ̀2 ^?ꀊ A " (<;  &/ -? ! );  @ɐ '  <@@   @& <; ?& ? ?  #;" < @`  <?&`??㿘  A " <;  & ?D  *` +;8B <@& &-@@`` 3  < `@*  2;?@&@`25?&` " .? &` ײ`<?&`?  : <`@$   `<?&`??㿈<: ̀ >?ꀦ(,? ' '`G' D ?   1; : @ : '1;'<@@    "<?1;< & ? ?㿐0  !0<3 j2 <:; < <  ? @F ?<; ?@X /4? $@ "?@F  ? ?@  @F 50<: @F `+< .` €% Ȕ|ۖ H?0? !0<3 *X0  !0<3 j2 <:!      Q@’ @a K -;  AB 2A  #/' @ ;/<);@ @  @ 2,0  " @  @'`@ǔ @ p"l@4ސ@4ܐ@4ڐ *@$< `@4$pl`C$l @2<h``a/<- @   " 4 `, "4 " @Rj4 ` `- `&`"``@V `d@``@`@6.h $h @Ԟ2 @W @U @7挡H/`m@2 @  $挄 @@7d-@ z $$L`"H`` ` @ `"H``` ` @H `"㿘  * 㿐#''^?H/`<9#D@Bh` '"%cD #<7 ! H/`c$@h` | <H ); `  dd  d@2  P @  0"  @  2  L   " H/`c$@h` ْ? ` <@:? L*  &@  `$ L  ؒ@  !  ܒ@  !ܓHo`c$@h``? ` <@: ? L&@ )"` k t x@@ `H/ c$@kh` 4 8"`8 8 4"4 `"  "` `  x"`| t$ x$ 48$ 88"`4$8 x$  | $ "  x" |$c$H*/ K 0'Ґ0$ H/`c$@h`     > ?H`cD@h` `2"`%cD!㿘 2 02 @02 02 02 @07㿘א (  c@c, . . ?㿘 d@* @*`"@*`@*`&`@ d&@㿘 "&  ?0* ?0'!</  D @p0 <3!İ"@ $  D @` 㿈`?Œ <;@ @    2?㿘     <3#<3!@  & ā㿘qn`   9 "+`  ?0/(?0,!</ D @.ox @<!`!<3#<3!@ ѝ!  2`!!`2`!! x`"<; @ <  ? 21? @ @    "?@8 耦 ؐ 2<0; @d    ? X@ @o<3a@ d<9cLcL'<9`*`*#Ƒ* '7'p'Ġ2@G<; @2 @  @ ? <"" 㿘<:! @<` <; @?"@2?㿘T ! 2<7?; ?򀠠2*?H<9d@Ch`3<3aT1<5>@<3#&#&aT l&9<3;<3'!'ah#dH( 㿐 <; @    ?` <;@ <:a@    ? 㿘T@ !! ``6?.<:@#a<:$a``%"  #"$H/ <9d@h`<a*#" * @##"dH*/  " L 㿈 `<; @D    2 ?` <;@ @2      ? ` 㿘 T@ !! `2N?  @    c  8=? ? , ؒ@g1?H/ <9cd@Eh`<3<3! P /<3!<3%<:5<37<39<3<3<3  T? # @ @ %T    0"$!t  5<3 >#@7<3?9<3&h  7<3 >#@9<3 ?&l  9<3  6'!\?<3x<3`h<3  @T _#a \ !!<: !(<3@? * <3 "aX T <3!| <<##!|!|T" #!|`$& @aX* !t!t : "@$!t: $!td4 @;  !\ !t* :"@ $!t!t* :@$!t<3!`!t $!t &$!t@ <3 ,? ؐ@'( <?T @@2 `a"   b"`l"    @@2<3 & !X 6: : & <:a,<3!t#<:0!<:hl%<:T'<:& d)<:!\+<:& <& a`;`!<& a4& & & @D& ,!H& 0aL& 4& 8& <& @& D& H& L&cdH*/  $<; x@   ?<@   ?㿘<3 </`Hj  </ D D : @ :   H<" +   `" * X</ L L+   @ :  </ J`" <<H*/ <:<:aX!T H`</ Pj2' !T*@#!T*<!T 4 @ `H/ <" H"*2 0ԝ㿘<:!h  %<@    @t /$ <@@g`0㿘@@ l̰l"    ?:   `@( lѐ㿘<] Ȓ  @     , `2  <:<⏐ H0!\  `ȑ, "@""  "@ # <:\ 2  2 " 2㿘<:!\  ?㿘L &@H<]   `    , `2  "6 lC k<: !\   ?` @*8 :  :  l>` ȑ, "@""`  "@ $`  ׼׌ל׬ĝ㿈 5`1?-?<; ?`` ?<:!l#\'#`@R ?@0/? 2?p<; В@ (  ( ?0  !0<3 j2 0? !0<3 *㿘 > ݐ 2>   ?㿐\``2F?쀢 "C?;<   ? 25?@?2* ,   Ȓ  2%?  #\#`  2  Ȳ#\#`@  2<?㿐` \` `  " i?`#`#\ X4V   Q M0 /`<;<     `@ 8 `   @ `2)?<?'``?`  @8`  <;@ @ `? 㿘 @.X  ` &&  & <:!l&  &  " " <:!l&  &  "" <D@c㿘  "`  "<D@Uc@.㿘 J<:!)  , >     <u"3@     @ ,`(@ ,   @  " 2& ,` 2`@  "$ ,  2$ &  "  2 㿘 '#<  @" <  )b , ( 2  , < 2  ,@5@.x&  , 2 㿐` ` "!? , "?   ?  c  "  ?'@ 㿘Ӑ 㿘ʐ 㿘 ";㿘  "'    @`s'< @  ;< @  @ ?`V* :   @ `@ *<@ :`  <;  @ `2@? *@ B 7>@  @ 8 @8`"<;  @ `?@< @;@  . ? `?'@B > 㿘!<:  @jf @Şhx   \    @` '   2z<|#`;<  `?` `     <; @  2Ű?,@'L@ - ܀`'ܦ  @?А k @yL @ܠ"@ J@  @<|#` @` X`2 $G<"- € =& 9& 66 3& $0 -&`'ܐ /'#<@Oc@{@ѐ8 <; @  #$  `??T``````<;  . ? 0?`'<|#`;ܔ `'<   `?` ` `܀`` ? "'B>㿐#\ 㿐T@@ !! ` `` @ #\˚ ?x 'L      @`2 ('  (  2` $`5<|/;`j` ;`<  `?` ` ``| `   <@Ĕ 2?,'L - ܀`'ܬ  @?А U @x ܠ"@ J@  @<|` @ D`2 $@ 0 `"-%@)`'%`'ܐ /'<@yc@8  <@h  "$@ ` k```````<;  . ? 2?``'<|#`;ܔ `'<   `?` ` `܀`` ? "L'`BL:㿐#\ d㿘  \ l?H G`<;    ? 2X? 4`@ 8 :  < @͔  2;?<  . ? 2-? ?' 2$?`  8   <;@  @ " ?"? * `6\3" $0? (")  80   ;  < @  ``݀ 4?  ` 㿘5\< !;   ? 2C?`2@?   d @& ? 21? `< ' ? 2!?```"<?;@  @ ? *` ? *   * "@ 㿘@  L?\  E?ꀦ -<;@<  @  ? 22?򀢀 @ -? ?&@ 2%?򀢠  @ ?򀦠<; @  ?/@ 㿘 L? E?ꀦ 0<;@<  @  ? 22?`@ -?  &@ ? 2"? @j    ?򀦠 <; @X    ? 㿘\ K? E?ꀦ .<;@<  @  ? 22?@@ -? ?&@ 2%?   @ ?򀦠 <; @  ? 2 0"0@@?㿈<;<    ? 2?f#0@  ? ?& 2z?y     ? l?򀢠<g? cj2 , `")Ho`<7c$@h``: <* c `" `` 2` "?  \'X'T'ܑH/`<7c$@h` * <@ @T   ?㿘H`1<7#$@h`<H 4 d2  4@'"T'"X'"\ 42 dH`#$@qh`H`<7#$@Th`<H4" 4`" 4@"T@"X"\4 H`#$@3h`㿈<;<    ? 2ϰ?f#0@   ?& °??     ? ? "<T! !! `2<?@@    ?<` @@{    ?<` @@l    v?<?cj2u , `)Ho`<7c$@h``<  <* c ` ``2` 2\+?\X # \ @   ?  #cܒǖc"T"X"\cܑH/`<7c$@Uh` c*2 0=2 0㿘0  !d !l!0<3 j2Z h@ @ <H h``"$ @ "@$ h ` @ "@ $ $ 0? !0<3 *Ho`j2- *H*o` l  < l+  `     `( l `&l Ѓ111?!T!< ;     <" ?` < 㿀<<"<<cH#P''<<'''_ఒ < <#X㿐h` <#?<<# @# : @ :  2<_ Ȕ `" <# @?<!tj  <#ה  @0xHo`j2u '@'a8 ?""昔+ 搐*@ @ ",@H*/    Ԡ     <" ? @6H/ l@22 @!!昔+ 搐*@ @ ",@H*/ @< ([  2 02 0΀2 02 @0ɝ㿘<<cԔc@"㿘 I<  E.`8 -<+<@"  4@"   $@"z)@"v@"s  @@"i    `h@"a `@"]@"Z@"X`@ ,`@"R2㿘 ` <  @<@"? 0 ȁ㿘@"7 @"2&p " ?x'L' `(`  `?'@"?@" *`'ܺ?'`@"   @" <֪ @" @􀤀 @!@ @! @!@! 8 *`'' @!֐ <! x@!ΐ @􀤀 g` @@! ]@!@! 8 '  8 8 5<@9@! @0@!"2 <<cĀ *'<< г* @ ` @!􀢠@!L` 2@!xЄ @`@$  `@ ܨ  `R ?㿀@'D'@!U@'8'@!J"@ 2  @!E <!@!= ' ;7k@@!3@  ;8 8''9+ %@!  <վ!p@!< @!,@%@ 4  - /<@?$`@ @  @ <<#Ē#2` <<*cА *   `  @0  @1  2@   '@  '@ yD`T " D"`Tx''p@ 'L'p @ 8h']? " '@'ܪ8'@  %@ @  ;8<<`L@ ` 81/<@ x@"<H@ q @ l<<#Ē#2` <<*cА *   `& $p@0 $p@1l$p@ נ    ܐ  '쀥 @ < ?p@ 5p'&@''p@ ('P'p @ "8't? " @'Ԁ'ذ8"@''@  ܒ& @  @ 'Ш+<7<<93<<@@"2 Ā@ cБ*` *   ` P@ڐ@א <z!H@А @ː"ĕ2 * cБ*   `& $@/z $@0͐$$ à А@ @  Ԑ ؔ '耥@ ~?p@㿘@@ @/H@㿘<<<&@cġ2 <!<<, cБ*  `@ :  <! &p@b@`  @+c G ' @S 2 @+V :  @<@B`@>@<@:@70ܐ"@+:  㿘 @+g 2C0@" ">0 2:0@<<<$ė2 r*!<< Б* `&!   :   )` $%`@.@  `@.r@@@@@0? !0<3 *`9@* J ";0  <<@`T "`T<< 2@~`0@~@@@`@@@@@0? !0<3 *@*  <"@C0? !0<3 *`@* ?㿘@@ B@  <"x @v05@r@@-@j  <@ "x@a0 @]@Z @Uo@R@<<<&@cđ2  o"@@zӐ@C@A㿘 , &@ $ @1Ӑ@) $   0// 0@@ 2 ,㿘@ t " x x 㿘`(   $2`@+@@>0`,& @ @@@)ے .0@ΐ<" 2 * @<<Г*`@`@ @@ :  $ T` 2T .T"T!`@&!@@0? !0<3 *㿘`<<@  *  @)͒ ?@}$`@@@@T"T!`@w&! 㿘`(  2`0? !0<3 *–J 0  0? !0<3 *5 2!1?`&!@T`@8"T`@5@0@.<&2 * <<@Г*`@ `@ :   `  +  㿘!@@ @ "Z?@ 20S?  !0<3 j2e @@  v2*@ِ@Ւ@Ғ"0 @Ð@@0? !0<3 *  @@㿘p@ 2   &0?  2 0㿘<!`<A #<=`<=!<=a<=ᘡ< <= <<!  Ƞ @v: @u d$  㿘p @0  !0<3 j2 , 8/< 0 p@0  @M$@ "*$<)0x#@& 8 0@ $`( `20$4     @ 20$<0<? !0<3 * @IN㿘p  "?  ?0<c"`@? \@`@4?``@`\*  >#@ 8?:   "0?ꀎ" "۰? ` 2Ѱ?`h "` @2`"` @  `" $$ @u   "?  ? 2?ꀏ / <?@  <c @v  ?$ a$$ `b  4  p4    4  2  ?# @p4  << cܑ* @$ $ ,$ ($ 0$ 4@V c?`X*  ]#@ V   @6 H"$  (   ` <??"`  `€` `" 2 $ 0  $   @U @ `X6  $`X`\ $`\M0@   "  @ @㿘<@ /1/ 0p@$     㿘`i?@  ` W`` P` % `` VP6'  4 ' '`7 7`;&@'`' &&7 7`61&@%`` VP6'  4 '  `7 0`&@ `' &&7 0`6 &@&W 7 ?@T 'P` ```@#`    ?&@   #  #@ " " 2&@  \ 6  "   (  *        (     (  8 2"㿘 "J&   "@& (:&`       ` ` `(    "&     2  " < &<A"& 㿘6 X" "X @@`\" "`\  @ @  ( "  0 `" 0@ 0 <@=<c@09 @ 2& 2 ," & ,*& &&  & & 6 (&(  ,"@&, 0&0 4`&4`  "` ( " & `"& @& p@p@~㿘` `" 2 `  `82   ` " `   8 ` ?2 2@ e" 㿐/2?<"@o02p? "  @@: < ?#@4u?<c @  k?    $@$  c@ "I * C   (  $@  0`" (" ` `" `" $ $"`$ $ "@$@|@tݔ 2 `@ 4$ 㿘p` @|0  !0<3 j2 M0? !0<3 *p `@|s  &     P# @`2# 4 $ $ "O  2 㿘& & && T& X& \  "B   " (    ( `" @ ?&  0` (" ` `" `" $ $"`$ $ "@s 0 "<@   @ 9  2@ f?$@ $` $` $`  $` $` $` $` $`  $$`$ ($`( ,$`, 0$`0 4$`4$ $  $  $  $  $  $  $  $  $$ $ ($ ( ,$ , 0$ 0 4$ 4$`& & $ `  ," @& ,`  ,"  $ , 06 `& `  "`  ( " p`" p@ (@p*p'  㿘2d?o 0@ @Z?2pV  `@n P0  !0<3 j2M p ,?(    "? ?2* ` ?*   p30? !0<3 *p `@mp@2 0Y@㿘 2   @D <6 c@ 5  "?$ $  $  $  $  $  $  $  $  $$ $ ($ ( ,$ , 0$ 0 4$ 4& $    ,"@  & , 0`4 `  "`  ( "p`"p@p@%<<c@   "?$ $  $  $  $  $  $  $  $  $$ $ ($ ( ,$ , 0$ 0 4$ 4& $   ,&@@$ ,4  0`" (`  "`  ( "zp`"vp@rp@    @   2@ ]e?$@ $` $` $`  $` $` $` $` $`  $$`$ ($`( ,$`, 0$`0 4$`4$ $  $  $  $  $  $  $  $  $$ $ ($ ( ,$ , 0$ 0 4$ 4$`& & $ `  ," @& ,`  ,"  $ , 0`6 `  "`  ( " p`" p@ (@pp 2&2` \ "\㿘T@ !! `o<?o 0@ 6?2p2  -??0' Ŕ#  "?@     p㿘p?` @l=0  !0<3 j2 /p@/`\ 0#6`  @02` 8 0<<cȑ2  0? !0<3 *p `@k 㿘p `@k0  !0<3 j2 /@ o0 pR 0? !0<3 *p `@k㿘T@ !! `4 ? p* "``p #<  @?Ȗ*   " p 㿘p?` @k0  !0<3 j2 20#?p2 `X 80p<<cX2 800? !0<3 *p `@kGc 㿘p `@kR_0  !0<3 j2\ t 0? !0<3 *p `@kL@2 0̐@ϐ@2 0 6@l@2 0n@@2 0@㿘@@ , @{  <!P@s!@n8@@e  <!x@] @X" @N@L  @G@   @<@9 㿘@/@+"% p@ `p @ @$p$p@ @䰒@?㿘p`? @jO0  !0<3 j2 o20o 0 p@ &@0p Ѱ? 80 "@80  p`\#* &  ? 80# @ ?p& X*` @ @ 80 ` 2  @2  &2 "0 "@'@2 ! <`2`" @$ p&`X2 "`X  @p`\ p"\ol?<c @b  cꆒ [p- U& & & &  & & & & &  $&$ (&( ,&, 0&0 4&4&&  ,$@@&,  " ( " p`"p@pvp*p6 `X "X@ "0p \@"\e0@?0? !0<3 *p `@i8@2 0@㿀<.''@ِ @נt8'5@̢"@  '['@  <f!@P@ @C88 @%@9)2`@  <@B@'@ /<@@$0@`@ @{@ *@  Ʋ  @`㿀<.''@V @Tl8''@I a? "@ ' ' : 8@0 +%   @58 89<7@ " @R " ?@@ $0 ` ?  ͬ 2?쀢 "@    *@ 㿘 @%  <=! @   t&08? t      :# # @ # #@㿘 o <Y"80"  @0<= t   t  "   2 <@"`㿘/0<<cđ*      ' ǐ @  <=t 5  @)@:; &<  :`*` @ "p ;<  :  @* ` 2 "㿘 8%< '<< ` 8  `` 2 8,` Z`&`@ T` `" #2`  0*` * Б*   @`"@g`( @   @@<=a|@㿘<#'T'X <#0W<3 <<*ሒb @   < `< (y @< Ho04X  T` < hb0'< Y   < O  <=! @   @_* X`<` ;& ,  a @o hdb !@``"!` " @[ @\3 @"@\n "?@[@`2 ?$  <=!   0?& 0 04 <= x *  0` (* , @($ 0 & 0 @ 0@?* $@@[F@[& $@ @[ @ 2` . . 66@[  - 8- & <@Z& @ @  & D  s+<= @2* & TTX& 4#m<_& & & & 8& && & L. ̄ @f<=!  L@O < P2 L<= `P<_& P"`P @eԞr㿘 <3  <3 <<*ሒb @   < L.!`6<_ ̄ @eŞT<=a `P  `P@2 `P<=ax2` P"ax 2`P`̄ @e><!@ 0\`̄ @e8H/  j@22 @ $  4   20 "- "`" .@H*/ ڒ H/ l2  $ 2    2 @ .@H*/ 㿘Y 㿘 <!hf <3 <<*ሒb @   < Lu!S <_ `̄ @e<=! Pa  2 <=x P"x P "P`̂ @d <F!$    <@:a  !7 @dߞa `P& P"`P @d 㿐?#@ < L"`@ @2= <3 <<*ሒb @    ` < L"H``  Ho` j2e  D?& D  @& D <@Y $ `& (& $,` 0`'@ ` %`@<$@2  0* << *@ #В* '!2 '(??$!2$`@ @@<=a|@ @Y    * @` ? *@$$ $y   $ @ T@ _$<$@2 *  0@<<А * *` ' "@"``"@d`(? '4$  ? 4 `@$`,`@$$H/ l2 )pː#+$ $$& "`"& $& H?& $,`>  @@<=a|@<$@ 2`  0*`  <<+ Б* ? ? @`"@cў??`(@ L H/ l2e  $& $ *` 㿘<"``L<"Ɛ 㿘<"L<" 㿘 <H` j2. )p #+@W `2!   $ @`$  2  &@ &@,@0~&@@X:  @&@ &2  2   '2  """` """ "` 2  """ `"""`" & 2  0,@ H/ l@2 @H/ l@2 @ `"w0<"A,@ "7  㿘 `<Ho` j2   N @@ )pː#+@d, 9?$ "$ "  " ,`0f` "&   "`"  $ $ & "  2& "`" $ $ "  "`&,`<#<&@2 * <<Е*@ `  @W&@ * @@,`<# 0 Z@<<#H0#`,` <"㿘<=`| `|@8`` <H` j2 )p #+@U `2!   & @`&   &@&@ &@,@0 @WF:  @&@ $2  2   %2  " "" `"""` 2  ""`" """" $ 2  0,@Ē H/ l@2q @H/ l@2f @ `"y0<",@ "ޒ   @ N<#p 㿘 <<<&ę2 <<+  cЗ*  `"< ``@<H`` j2 ` N` )pː#+@], 9?$ "$ "  " ,0_` @"$@ ` "`" `$ $ $`"`  2$@ "`"@ $ $ "  "`$@,<#cА   `@U& * @@,<# L0 Z@<<#HB0#`=, <# 㿘 <<<<&ę2 <<+  cЗ*  `"<  @< ,@<Ho` j2m   N `)pː#+@],` 9?@&` "&@ "`` "`,`0^` "$` `"`"  &`&`$ "  2$`"`" &`&`" `"`$,`<#cА  ` @T&`* @@,`<# 0 Z@<<#H0#`,` <#@<=||8㿘<3 <<*ሒb @   <!#0<_ ̄ @_Ş<=ax #m    @2n PH/  j@2 @ $ Q (  ?K$ (   " *@H*/ < Lِ#> P     2  `  2*@H*/ `" P * P  *@H*/  P!x2 %!x̄ @_%G`fH/ ` j@2> @`$ J ` E`B 2  2 @ 4 200@2$@"`" ,H*/ e H/ l2 `$  ` Ā ,H*/ 㿘H<` @K<_`̄ @^ž<= /<!   H/  j@2 @    @   @T ,@  L@@K{ P Ұ`̄ @^n5w@"@%@@ ċ@2 @0ɀ2 04@H@^@b@2 02 0Q2 02 0̀2 @0A2 @0L2 0t2 02 @02 @02 0ހ2 08@2 @0K@2 @02 0@2 @0+P@㿘@w " @r<<<$ė2 <<*cА *   @], @Z` @] ` `2 a" d` @C@>@T@7"T@ m   ` <= <=*` ,  <<ᤡ, @RȀ W @@@"N  2J @ `(   `@@@ T# T`( € '  #@ ] "@ T# T!@&!@ܒ@ܐ@l` @]> @` @>   㿐'H`@'Pq fp@H`h''@ T@  <I @I @  @  931,@  <*h@!  @y @  fp$0" lHP 2   2  ʦ     㿘fp l* "fp *s "   2 fp "`hfp" l㿘<9cĠ @QF $  &a #<7%<H  H/`c$@\0h`  4@ a "`4fpT  ""hfp h (`4 `4@2aH/`c$@\ h`  "  2    ?  !?  㿘0   !0<3 j2s # "(0᱒ 2?  0@y 2?g 2?@Wi`ސ0? !0<3 *`  㿘 $ d$ l<`ؚ?4"``<=4"`  4" `(!,"$&$ $&)<'<=Y!`@  0  #   <$`@ 0【2 0p<=!7  `'D  <Ӑ 0<=!!`*7 `<=! :`@ 8  *  <* b ?,(@  <!0e `- @`2<!(D <<!`!h 0O 2<!p0G $<!0@5 *`  (@[D u<=К!'ЗH`<9#D@Zh`! '#!$cD+<]<!P'  "H/`l2 b4%b4,     €"` 2  !. .@@Zb4!H`cD@Zh` `2"`$cD <!0D  <5 @Z؞<5aa "aaa "a @Z 'غ+] "6< `d`8 2`h`D  -  `d D €,` >$ `<"`h  "@  -  ؒ@]{,`$ ' `%` "d5 (`  @(@Zy<=<"0<=! # @Z80?<!0;   @@ZB<=! @Z$  @Z4  @Z//`D2@!  !`"8``8` <L"`㿘<=!6  `@ <@"0'*` *  <* b 6 ?,.@ <."00`(`  @(@Z2<=<"0<=!+ #㿘<&6 <<.А* @  <#"<Ð"$2 <#0 <!0㿘<& 2` <<*` Б* ` `ॐ @Y$@Y<ϐ#80"` <Ȑ#p0<#`$`$`  @YS  @Y`$`$@Y㿘<&6 <<.А* @ <#0 $<#02 0=㿘<<<=&(@.`@ .`@ .`6@!ĺ?.<_/@. ؆>`. '"!2` (І(?"` /```&  6 ~6`(` (@YB *Є @(  & ` "@"` 㿘    @Xڞ "<<< #Ф& * *  *  *   &  : 2X ?*`3 Ho`<=!j2 (<=a<_.` ؒ@*" #a ` * В@*`&` @ @ +`""6  6 `(`  @(@Xɞ , А@*  "" "` &@`&` a*`0 + | + t * @"#@"`""`  !㿘<&<<cı6  <<. cА* ]㿘 tt@ #<` @?"`"?2t;`0t@2` "!<1 `㿘` 8 H`<=!l2, hN#<=a'<= @F<!!` @@  Q !aĀ 3 2 ,H*/  @!!|ǐ *@!Ho`l2  @` aȀ W.`<_`؞ <=!ȣ+ !<= F<<#Є`# * *  *  *  : "6"0(`+@Wٞ! "$!" + @<t # #" `6 0 (`2@" ,"@W* * @ V!`` <_ax <=!ȣ+  !<= N<<#Є`# * *  *  *  : "6"0(`+@W! "$!" + @< # #" `6 0 (`2@" ,"@Wc* * @ !# ,.  `` a* 㿘H`!<=!j2 <#<=aĐ 5*`<=ᄚa<` `+<_`<1<7< `  Ȁ  < < , @*`@   -@L.   ݀ !*@㿘6  <=*!@ *`@ <"6 *`  @6  ** * %<=`,-`<=`! :`@ . ` @` @> `*  2@ `* @H "?{ ?Ӱ 㿘@ 2 @3  e <<#<$ *` *  *  *  : * @R <<N?#<$ *` * @ * T *  "T !: * `&!@ؐ ""`    ` ` $:`@ ?@  2?   `@ @`@@@@ 2 022 0π2 02 0㿘<=<=<=!<=!<a!㿘<=â  "ā$@UϞ<<#В& *` * * * :*  << !0K   <<#Д& *@ *`@ *`@ *`@ :`*` << ݐ!p3   @Ul<#o6`  <0@ <=<` ! @ & & & *`#` &  "` "& H  H& & | &"  | 㿘 4 6  0 <=! -<* *  * b . `,2#*` `$<%`3<=!ܔ `"!<!v ` 2@ <!<"i"Pc㿘   6   <=! <* *  * b . `,2*` @ "<<;"<"<"2#,㿘<=a   "a<<#Д& *@ *`@ *`@ *`@ :`<*` <  #P0<#<<#Д& *@ *`@ *`@ *`@ :`<*` < # $@TϞ%@[㿘<&6 <<. Б* @ $!   ` ` $:`n ?@  2?    㿘<<=#Ԑ 4 @4  "+<)<#<=c! * @ "2  2  2   @T)  @TR "  < $ aؐ $aG @c<t#=  㿘Đ .  '  "<$2 * <<@Г*`  :    @T , 0  @㿘<=` <=<(`((s "8 .& >(@0)!*&  . >(@02&  6"& & & (  "(`(?`0/.`( ` @(`((`$$aaa   0` (`(($$u(`aq `o(` 㿘 S6  P <=! ;* * < b*  `5 <=`$*` *  *  $@ #`.  ,2  $*  ##@#* `0  *#  8# <=a "a<K 0 <G @0 <C x0< >㿈'D ' 'L'P8'9@@"@ `'w'@{@  <@ @sl @l@P<"@2 8 5)@%@O`@X  <@ @PD@J,@.* @"0$p@< L@7P 2%$p@1@.$p@2$pDP@%@#@ 5L<<#Є `@RTD`T "`T$p@ ͠    {㿘 <.   @Y 2 㿘. *  <. * b1<H  3<, @     ?`@ `s *@*    << `",c?#В$@ *` *  *  *  : * @Ho`<7#$@Qh``  4 <H &p 42&pH/`$@Qh` @pr`$ڒ  ",#<!<=! `2}"! 80   ?!0<3 j2 T@ !! ` @2 <ڢ<=!? <" @@ 2 *  !  +` *  * `0@ +  * < *   ``   ـ2 ?ꀣ`+` 0 $ * < b 0* `0"@`2 "` $ U?"<* *  * $ $ `0 +` *  *  * *  *  & `$ 0$ *"@ *`" *  *  * " * ":$" $ *"@ *`" *  *  * +`" @ *`* @ "*`: 0#  5$  @I ` 7'`@   $ `€$`@JD<=!  ( "@ $ "! 4  $ $$ @J20? !0<3 *㿘  <`"O?<a0@=|<=a  A 7 4 @M<aX@=g `<a`<ah@=Z ,  ( $ < 4  +` 2`@ +`ax*@=<* à 00 ' ? 5 !0<3 j2^ T@ !! ` `@H\<= a<  "     4 2    % ? $ ,$ 0 $$ 4 $ $ $ $ $ ?/<=a?"a$ $@1 <$ `< " @@ F? *-`4@4  7'`@ 2 @s?<ل 4* c4@` `* @`f  ?<" U 43`4* @`$ `* @:` @B  ?<"    . 4`,:  e <ɐ!?$   *`Ք< !$ @Ke   <!Ȓ@K] <!ؐ   @0 @Gc $ $  :*  2@ `   "$ $ $ ,  $: , J*  $  , Z :*  2@ `* 2@ 2@ , :E`<c"?$ ?$ $ ,"}?#@*`$ ? , @G.*`   *$ ?* ?*2@ *  ," `?}2` ` ,<"0`2 <"`?l 2@Ր G$ @F<= @"< $.`$"x$ (<=a "?* *  * $ $ `0 +` *  *  * *  *  & `$ 0$ *"@ *`" *  *  * " * ": " $ *"@ *`" *  *  * +`" @ *`* @ "*`: 0# '  "   $  " < 6@G  $4 $ $ $ <=a "a쀥 0? !0<3 *㿘<= & <&$< ,<.((( @:$  ((.`2  $&$ & ((`@  *α.$ ( ( & &$2 0>2 0@<=` 㿘#<=a /<=  "!<=<"   $"a". 㿘<=!j@2o @!<=! 2 뒐 <="!<=!<=*` """ $!  a*㿘<=!` `Ԑ `f  3.` <=!j@2< @<=  @A?@Bْ .  @@ 8 .  $@    @ "2  @7 2  & " " $@"$  " $ "$ "  $$$  " $ $<=b$"b!*㿘<=!j@2 @<=bb"  " 2 2<"I9<="aa @ " *$"`    `  $ $```   @` $`r$@*㿘/,/:  ) 㿘㿘<=!` <=!j@2n @<=a  `  `@@`2`<="  `  ` @`2`*<=a<<@9[c0*c0@9U<cP@9P<c@9I<c`: @9;: <c : @9-: &2 @02 @02 @02 @0㿘0  !0<3 j2 @-6 <  h  ? ` ` @@E0? !0<3 *㿘0  !0<3 j2 l?    *@ "!0  & "0  ?   h  ? ` ` @@ 0? !0<3 *x` /?`L ! @K' H'ؐ@Pذ D`d   <` @ @Ky?!㿘0  !0<3 j2 @, <L < " @@ B?@*ے  < h ? 4 #0?@*ڐ + ,   h "  @2 " @  " $$     @@_  u@*@D0? !0<3 *㿘0  !0<3 j2$ l?    *@ "G0  $ "B0 `;?`7<"  0?  ,c(?,  h `@ @ $`@ $$     @?  @ 0? !0<3 *x0  !0<3 j2 @+Ò <B h ? 7 p`$'<;@  @ ? '<`  `'?'찒 ؐ! '&@  @)  @Oذ@C0? !0<3 *h0  !0<3 j2i @+f <2 `h ? ' p`'<;@ ?Ȓ@H    Ȑ!'''ؐ @)  @O2ذ@C0? !0<3 *㿘0  ?!0<3 j2 `@2.0 11 T!T\!T @+ < @)W  `   h  2?@C^11 !T0? !0<3 *㿘0  !0<3 j2 @*Ғ < <" @@  ? @)  h "  @C)0? !0<3 *㿘0  !0<3 j2 l?    *@ "&0  & "!0  ? <"  ? @(ْ   h `$h@B" @ 0? !0<3 *㿘0  !0<3 j2m @*Z <% <" @@ ? @(  T@? !! `h  "  @B0? !0<3 *x0  ?!0<3 j2. l    *@ "10  & ",0 %?!h ? #?.`?2`#@" <  /@ A7'ؐ @Mؠ@0? !0<3 *x0  !0<3 j2 @)ǒ <$ h ? #?.`?2`#@" <  o@ A7'ؐ@Mذ@B0? !0<3 *x?<ǐ 00?h ? 8#4?.`?c2  "&.2  "(" F77'7"h < @   G7'" d$< @ ؐ ;`7'ؐ@MKذ㿘0  !0<3 j2[ @)< < .`.22`@A0? !0<3 *㿘0  !0<3 j2: @) < .`.2y2`@A{0? !0<3 *㿘0  ?!0<3 j2 l    *@ "0  & "0  ?.`.2`E2@0? !0<3 *㿘@t F?`  & $6  d2`@(Ӑ<2   @' '  > & & (& `d " &  "  $ € 2  $?ܐ! @ & $ "@&@@& @㿘ll?`   `3 *`l   ?3 `"  "@ ?2 ?   ? 2 ?* ?   ` 2`` .` @M ` 4 @L "l0*  *@  # `  , * # `$`  <K P`"@㿘@%Ԑ<:0  !0<3 j2! y  &|. l "@ 0? !0<3 *{ 0l6  *   * *# l`  "  㿘&㿘  ` $€  & @&$@@㿘  < x     `" @  @;#@㿘0  !0<3 j2 l?  `. @. `"@l6 *   *  8 @" l *" `  " 0? !0<3 * 㿘0?  !0<3 j2s T@ !! `" 0Ѐ  @0? !0<3 *2 0怐2 0U@k@2 0s2 0׀2 092 02 0݀2 02 0M2 02 0̀2 02 02 02 0䀐2 0ڀ2 0N2 0    ?` , :``@C? ?`<3`@  8` `( `T  㿘0  !0<3 j2O l?    *@ "$0  & "0    ? <>>` 2  @ @0? !0<3 *㿐0  !0<3 j2 l?    + @ "?0  & ":0  3  / -?    <> @ `"@`2  ? <; ? @Cy    " @&0? !0<3 *㿘0  !0<3 j2 l?    *@ "80  & "30  ,  `h   @2`"` @ `" $$     @9ٚ   ?   @ΐ0? !0<3 *㿘0  !0<3 j2` l?    *@ "P0  & "K0  D   h   @2 " @  " $$     @9`& "?   L ! @DC  @D?!@^0? !0<3 *X ?ꀦ.  x?  ?<; @B c ?ꀦ  X T R `    h ` @2 " @  " $$     @8 .  @}n!` ?ꀤ   @`  "N㿘0  !0<3 j2w l?    + @ "0  & "0        I@0? !0<3 *㿘0  !0<3 j2@ l?    + @ "30  & ".0 '  #    ! ``L@C(    `L@C?!@C0? !0<3 *㿐0 '' !0<3 j2 l?    *@ ";0  & "60  /  `h "` @2`"` @ `" $$   @7 ?    @0? !0<3 *㿐0 '' !0<3 j2 l?    *@ "U0  & "P0  I  `h "` @2`"` @ `" $$   @7, (?  $ !  ! ``L@BU`   `L@B/Y?!@o0? !0<3 *2 02 0쀐2 0G2 0ِދ@Ɛ@2 02 0@@2 02 0U@@㿘<`@.ʐ<=b '<` @@.  `<`@.<?b '<` @@.  `㿀 ?  . * @ 2   .  . @ `2  @.ِ@ 㿘<<?И" ֔ 㿘<<="˔   <= *  "# ?* ?<=?*   ?      <? *  "# ?* ?<??*   ?    㿘 <=" . @ " ?@* 2?$@$ ?㿘 <?" . @ " ?@* 2?$@$ ?㿘. 6 `6 <?"*`  `", `0`"( @ !<!  @e,@ " ,@@` ",<! ,2  @x`4`" @ 㿘 *?)2   &`   €㿘 *2  "   $€  㿘 *? 2   &`   €㿘!<_". < aH2@-g㿘+ 2 <?b*@1<_<!X"8<ah @-R㿘+ 2 <=b*@1<_<!x"X<ah @-=<A,,"  ,<A"   㿘!<A#   )<A#,`"  "`  "?" `@8`<A<3 #0 & "& T#0& H & L&"##0&&  #  #   6!<A<_bxܣ  #  $# <M!  #4@$ <D! $#4 㿘 `@8! 6 & & & H & L` d@& 2` €㿘 ?2& @4`&  "` p"㿘 ?  & `"  "` ]"㿐  & 'H`<9#D@?th` 0  ,'& 0$cD%<] $4`"% Ho`<!Pj2 4$4*` "    €"` 2   {Ӑ $H`cD@?(h` `2"`$cD ?& 㿐<A#Ħ  +<A c X'* `S( c. 2  9  `. a ݐc  2 2? 4   `"   $ @)",  ?"  $  '  ( c ` c 8'* `+( c. 2    `  ݐc '  ( Ӑc ` ` l 㿘. 6 @ @<Y 㿘. 6  Q@ w@<J 㿘0  !0<3 j2  0`!0<3 * 㿘`@=1`h  " @   " `  `"` @`  㿘0  !0<3 j2 R l?    *@ "50  & "00 `)` % !? (  L ! @> *  (€ @= %?!,0? !0<3 *㿘0  !0<3 j2  l?    *@ "50  & "00 `)` % !? (  L ! @=   (€ @= ?!א0? !0<3 *㿘 ?#@2( ( <A#82`  8`J  `2<A<"#* @<#2#`P#   8" 8 2J&  F# <Acė*@ <_?"@  ("*  " #  4`" 8 ""@" 4&"@<Ac& 4?"c 8< 2 <\"?#@2"<T" <A 8#"8 (*  @*  "  (* @""& & 8㿘  <A #82` J <A*㘐& ~& <c6 `2$& 8& `8& 8`8" "`8㿘 ?#@2 (<#(<A* c 2 " & 8  " <#H<A&  `8<_& 8 "`8"  "8 (*`  "  (*   #  &#& 4<A#<A *2 (  * (  | <Ac * @@&"4"@<Ac& 4 "c܁<A * 2 +@ ;` *@* <A|+@ @  <A *       㿘. 2 є  $<" 2 * @<<cЃ(` @  & ` @ J #<Ac,  88 2  8`J@ 2 <M"?#@*<E# <>#2#` #   8" 8 2<H # <H(5  & 8& & 0 5 a , <3`<A<A ," ," ,㿘<_" <A2 c<=!ĕ.  :  *<A2 #*@0G"* ?@@ 㿘. ߑ2  @㿘 ?#@2 < 0% @   2   ( & (   2   <A#<A*`@@x 㿘 ː "<?& Ґ 8㿘   0J㿐. 2   `'  @`     "  Pj`h. 4` <A82` J '  Z  @w<ڑ4`* c0@' :2 * 8  ' @6  '` `   /  $@    ?@C ,   g, '` B    " S 㿘!<A#؀ # <Ac<_"c| 0  H@2#<A`$#& "㿘<A# z #<A  c؀ <A# "#$c<_b|E   @1ْ H<Ac԰ "c <A  cذ ?"$cذ 㿐''!  <#  " 2 @& $& & & & & (0   <A#wǒ #<]x 4'<A %<9$)<AHo`<!Pj2 4"4*`    €"` 2 㼓Ho`D@9h`㼀 "'$$D` !# z@   6    uH`D@8h` `2"`$D!d!㿘@  @9 0w> # $<"@2` <<*` Б*   b  b<   @8מi ?& ` H`@2`   <A "2"㸒 z"<A"㸐#v # @8Şv # @@8<=a @8 @8ބ  @8ߎ 0 0< h0 p` `<q  @8 @8<<#<&@ *` *  *  *  : *    . @8h`v #Ͱ? +<K6aL ` @88`   `$@0Q` U$` 6 ='`  Ԑ  @G`  V  Ԕ $@.`$Ԕ`$@.`$Ԅ  @7 Ԑ ( Ԁ "` J` ?$`  @7-  @7ܞ- "  ``2 " @L` @7ߞ @7`v  #N<A"2"㸒 z"<A"㸐#u # @@7<=a @7~ @7`  @7މ   !㿘`!  @7r```@2` $< 0 (<<@Ѓ(`@` @7Y0  @7nx `  @7` @7C @7?`h ` : 2 `d 8?€$  `h `    㿘!<<S!G   ? k <Aޡ 4 #8> J <A . <A<<A`" #`8`#`8#``" 8"`#`` $ 2 * <<cД#`. #*#  "$"0"# 㿐 $& $'  `   @6  @2'& $㿘 $` %`` F!``@2` 3<Ac`&c@<A #t#<Ap"& $ݓ    @O  㿐<A#%<A<:` !X<A<!x<A<!<A<!<B`P #<*     ` ` ` @2 2` ` @2`#\#`sa֑*㿘<B h  <B `tv # <Bv3 d㿐@ @4& <A<A#cĢ +<],`` I'7` ``  ` `. )'  2$'%  ' 2' <3!,   &  `"  @", ?"  & ' ?`(  `<"`$,`b4 &Ho`<!Pj2 b4%b4*`  b4  €"` 2 b4 $Ho`<!Pj2 b4%b4*`    €"` 2  㿘0  ?!0<3 j2 T@ !! `6  0? !0<3 *ǐ '?: $?ꀎ <B<;   <A#* "? *  <B , 40<A#"  0? !0<3 *㿐 !d!l<b@!0<B`" h` !0<3 j2B <A<#ĴaP3<];<B9<B<cԀ <A@<A#  ,@ X'<A@#䀤 `  5'  20' ,' 2)' "&'   2`$  ",  "  @`  ?  @ "  $ '`6`( @ `<"֒$  b4  b4 b4 #`dH/`n2b4&b4.   `d  €"` 2 `dr # a ^<ݓHo`j2 f*H*o`sԐ `?<ݝ㿘 $ d$ l<b&4"b`?4"` 4"`4""$& *@" 0``!0<3 j2` <A#  ` $pV $p2 0z2 0z2 0rҋ@r׋@2 0r@rs@2 0s2 02 0=2 0\2 020C2 0k2 0<B <B  *`020  *0"#  L 2 㿘 Pj  F@+ P&  !6 `& & & $& @K<@, O  "@&   <B@4<<B@+ 8  "@&  <B` 2<B<B" "``" L"`㿘<B` 4. 2 @2 L<B  @ L#`# L`"L@2 L <B L "L@(2 "# <B`""`ѱ ѯ \ P㿘 2 ?ꀢ <B? ` @@ " ? ` $ <B  `  "` ` ?㿘@<<B0n    @\  `[ ?㿘<B ?  2 ?@+9   <;@  @1  ?<B  㿘0  ?!0<3 j2   0 0 0? !0<3 * 㿘<B  <#X+<B/<-<  @ <#h<#p@``` @"   @@*   2 x`@ k< D`@c` !<@c`<@ޒc`$!, @& d<@Ғc`(#p@  @& d<@Òc`,+ @& d<@cȰ`0 @& d<@cذ<B ؠ ؀`)<`@"   @@*R   2``8@#@L/_$c㿘<B   < %<#<  ` @n /$ 㿘<B   @ 2   ` @ 2 㿐''H`<9#D@1"h` 0  ,'& 0$#D ! `m H`#D@0h` `2"`$#D!㿘<B  1 `(. 2 `@2#  "  "  `"  `@ 2   "  `"@2 㿘.   <B  " ,`2  2   " h <B0 2  @0?  !0<3 j2 . 2 :  *`ː@ ")0` #?< !< @ !<@(;''<@ @.     ?0? !0<3 *㿘<B   !<  2   # 2 !<B<B | x@  !<7   x`$ x@(x!< <& @& < @"&& "@㿘,2 `. 3Y '  !< @k0 !&!$&!0& 6 .   "6 6 & .  㿘<B  6 (` @+@02 . 6  6  㿘. 2 2   (00<Ba*  *@@0!< pF 㿘 ,    ` ?& ,$  @)9"@)7 㿘 "" < 0&`㿘. ̑6  a?`, ]" , ` (`", @, @* 4 <a<` ` B  @D < 7` " ` `" ` ` " `@ `    ,` !`  `@@.א "4`< 4``0!,`m # 6㿘@0<? 0. 2 2  4`*(?<B`l @/#] }  l<a< lf* l @.J@1=㿘T@ !! `20F?  !0<3 j24 @ <- <" @*@  h " 2?  ?h ?,   @(D 200? !0<3 *㿘 㿘. ґ2    ,` @ 2 `    `?㿘  ?* 2  "@d J@ <C<B l @.p `"< '? #?,`2 ' ? ?А  ? ", $, @'Ől @.!㿘'H@-H` H  " H@  H-? "   2  @1B 2 ? "   H "  H s ,_@ \& "  "`  㿘@ <  h ? ,@ ?@(yY @'_㿘 &@: < 2p&@3 W ".?`**?` "&?`"/8/ ՜  ?<; @,  &@ L ?㿘< B 00 '   ? !0<3 j2 T@ !! `?` 0;@  @ }?c jt0  mװ? e `@% `9@X <Y <`" @@ O?`h ? G` C`*6 >?뒰? 9'  '  7`€ (?  ?. ""0?0;@  '?#% &.b2 W  @&m0? !0<3 *0 " . $€ 02 02 0^2 0!kz@kg@2 0ǝkf>@kSn@2 0 㽈'D  `*,`'P@w4  '' 'L?4 <ؐ#8*` `$ `* @ 2P? ,`<   @"ɔ6`<٘#4+`   `*  :2`*  *` @"  ?''#݀@'@86` ? lP D g쎐bP`(  '6`<ڑ* c0@  /@ =?` 2 @:`@8&@4 @"  @6`,  $@  , @ ?s ?' @ @6 6 , @  [,  "8  P?I?c'@= $ B;@` '  &<;  @*5S  @+Ǟ D( DD`$@." @ @   @@Ҕ  @@`  ސ @` ` '"? ?` `%  @ @`  븐 @` ` '"?ǐ ?`쀢 D "`(`? "㽀'D < c8*2* @$'P`' * @ 2'P*@  ':  2 <ِ#4*`   *  :2`*  *` '  @ d 4$`#8 M@!G ;   @ @!<@;  E @ C  C?'@!- D'`( '2*`<c0@; @ْ<ڔ0@Ғ쀣8@ 42 @(    29?` & 2,`"  `"䀦 ` @V 䒢@b @ ##P'@B :'" <;@ $@ @(̔ @  ; < @ `*@    $# ` `"` "u ` 2`"   "   f    q"2 D "`(?㿘`c`*X @@" < ,`'  *2` 2 " ` $*  *7  &' (7 07 47 877''',: ` a2 @!2 @`*`$'' @''<;@ @( @  @  ?㿘0  !0<3 j2 @  <  d "   L`" @  @"0? !0<3 *㿘0  !0<3 j2 @ m <  d "   L`" @  [@"Đ0? !0<3 *㿘0  ?!0<3 j2~ l    *@ "0  & "0   d    L``@` /0? !0<3 *㿘40>?  !0<3 j2B @  <%  d ? ( ` d    L` @  @, d (@"B0? !0<3 *2 02 0M2 0}2 0<B`8?@8? 8@@8 "@"8<B882  ?㿘`d B? ? :?頒 $`   4 < $ $$ $ (`d$ `€  l.  "@  $4?}l6  *   * *# l`  " 㿘0  !0<3 j26  " 0l    . @`!?`  `$` ` `   <B!8   `"@?"o0? !0<3 *  <; ?   ? 2 㿘'Ho'L ?<? 0;5` L* @  o ] L@"L " "?!<?'@4  <  @%Ҕ%@ զ ? "!<㿘a0%;?`@&a0a4<@&a4Ւ  p 0!w$$ $ $ 4 $ ($ ,$ 0$ 4p  p" 2 "X`    p`T"`T7$p 8`d K? G  A` 7@   *@2( $  ?  cW  , " , `$ +  ,`"( #; " 8 4  , o" $ $ , &<@ @!@ ,`2  $ aԒ ! ? @&㿘``    ?  X ?   L @#+ X @#: @#.w>X _?]>R<    `$@2L?b  ,%&  `$ *  , "& %;  /" 84 @ $ , &<@ @!]@ , 2  $ a8 !â <# $ 8`$ 4@ } @" @" "????2 ?<; :? ,"㿘   `" ,@ ,  A  "  " 㿘   `" ,@ΐ ,  A  " 㿘   ,  <B <B!x& 㿘   `" ,@ , <B!x&   A <B!x&  㿘      ݒ &  ` ! 㿘 & 㿘 & 㿘`   ?& `  ?& ϐฐ  ฆ༐  ` " ` "  㿘@" & Œ <B@$  "a& & & & & d6 "& & ,& & & & <6 & 6 (& <& 0& 8& 4㿘w k?r d ]@ &T ; = @`?@ "@$ `$`  <B< ",<`$`  <B4`$`$bh  $ $$ 4 l, ,"@ l " %`,%@l4 *  * *# l`  " l4 *  * *# l` :  "`   @#ᒐᐐ_@`T_@_ؐi@_ېi@㿘  ,?< 1<  ?"/<; @?@X ? "? ȡ 㿘` " h ` <  (`@?‎`" "29? &@< zL ( 2<   "( T  !! ``  < "  ?T  !! ` ?㿘 d@€ "  ? " @ . ``` . h   㿘@^  P €  @A @ 㿘`  L@ -'@5 @ ? d`€ "@ L L @0 @ P €㿘#` d  , ̀ `!d,̰!@]0@Z?@W㿈L /X "X@IXL /"`G` @ =`<#X<#ph ` @ "@ ֔ < ϔ<(  h `@ "@<   @@`h  2 Lh "L &L wl  '2*   /2'$'쀢 `L /" 2` P "  € G 2`ؔ 2 `|2`   $@<!` ` ``d ?  `  0 ?` 0 c  " @u㿘ː< Ɛ <   @[?㿘h`@. `? jj@ @@2 <<а#`b[J   h"V ? " & `L@ 2  @2 ?`L @p@ 0 h ?  2 d` ?` { `L@G@ p l?"#< @(@e?@?뀎`^ X"  02hh ? B > { ? `3!?` +d)d( !h " @2" @  " $$ @  3 v "@n㿘h`.@   <N "  $  `L@˞ "?  @"    ? ' 2   d` ?` .2 `2    &  `L@}@@㿘0  !0<3 j2 <@ ??T@ !! `"00<@@?4 `" 0@ 0@0@0 <.c2 <80@Ð 0? !0<3 *㿘0  !0<3 j2e <M Q <C "  $  `L@ L` "?``@" `   h  2   d  ?  ah *@    `L@ƞ'@`@^ć 0? !0<3 *㿘` `  @??,  : !6? "" ``&@  & 2T   !! `? ?``#"`" <  ?` @?``@ ? " d "?  2@?  `@@ 2  d` `"`"&`&` d`€㿘0  !0<3 j2 1<\ | <R  L? `"@ $@ $` `L L@ "   @%{  @{ @ ?  @" `G  ``L L@k@  @i@~@|@zã 0? !0<3 *㿘` <?`  @7?I  2 !-? "" ``&@  & 2T   !! `? ?``#"`" ?<  ?뀢   d` ?`€㿘0  !0<3 j2 l<6  <, "  $  `L@p`  ?``@"  ~  `L@C@ݐ@ې 0? !0<3 *㿘0  !0<3 j2 <T<K a <A `"`@ &@` `L@ @ ?  @"`  `? v  2`` d` ?`` `L@؞@r@p™ – 0? !0<3 *㿘0  !0<3 j2m <n<e  |Y  |O` "  &  `L@E` .?``@"*  "& `  ?  `2    @? #?d "      `L@S@@@  0? !0<3 *㿘`@  `D?`  @?  : !6? "" ``&@  & 2T   !! `? ?``#"`" <  ?` @?``@ ?   @? 2 d D @@?[  :!6?"" `&@ & 2T   !! `? ?`#"`" <  ? ?@ ? G d "C? $ =? `  5  ha$@G@  ? "  d@ ?  d $`@# 2 h@3 h a$@S$㿘`@`<?`  @7?ƒ  2 !-? "" ``&@  & 2T   !! `? ?``#"`" ?<  ?뀢 2i  @"b? 2  <  @7?{  2P!-?"" `&@ & 2T   !! `? ?`#"`" ?<  ?뀢 2 d `$ ? " h   @  @} 㿘`<`" G0Y㿘0  !0<3 j2^ {<u<}  |q` k? "<  @?  |\` "`  $` "  &   L`L@ "   @U  @M` ?``@"  2  @     `L L@@  @ @@@@ƒ Ò 0? !0<3 *VՋ@V@V@VP@V[@V|@V@Vw6@2 0A2 0Vr@V_Ջ@2 0WV^@VV@VC@V;@2 0V:@V' @2 04V&T@Vw@2 0V@U@V@U؋@2 0U@U@UӐ@Uː@dLT4㿘0  ?!0<3 j2T l    - @#@@"0  @ܒ     @d    &0`#l@? ?  - @"0  $ "0 @?@ <#g6`*  @ 5`  "@?2 `?   @?` 2@ ?* ?     2  ` 1 @_    @    2 4 *  * @#  *@"  @  $ l,  "@ m0? !0<3 *㿘0  !0<3 j2~ l  ?   *@ "0  & "0 ? <#fY4*  5  "@?2 `?   @?` 2@ ?* ?     2  ` 1 @    @>    2 4 *  * @#  *@"   $ l,  "@ Đ0? !0<3 *㿘`  !"`$!?`$ @` "  ,6 2 `$?Lc  &`$ 㿘0  ?!0<3 j2 l  @ +`@" `   $ `  <m |.` €l#??@ +`@  $ ` ?` <#ef`6`*   5  "@?2 `?   @?` 2@ ?* ?     2  ` @1@ @Ò`   `@@K`   2` `6`* ` * @# ` *@" ` `$` l.` j"@ ѐ0fl3``*  `2@ ^ ` 3`l * ` * @Q# l3` *` ` * *F# D$ > @9 @3 @-+<$<<4@04B`"  D ??$D < 0`" ?@Ri0? !0<3 *  H/`<7$@h` <H` 4 ` 8 ` ` d @2, 4,2  " " "  ! ,2   2 4 ?`7'' 'x'|'xG " 4 Ir  4 ̀`H/`c$@h` 㿘 "#<" dc0 `< `<   22 02 0}2 0O㿘  `"Ah`" TS ""C<L @ !! `2dK? %8 2<B?;    ? 48€ <+?&0'2<#?; ? &0; :?, " &0 " ?   ?㿘0  ?!0<3 j2 l @   +`@   $ "@  "@"lh  b}@6b~@"<^ 3` * ` * @t# l3` *` ` * *i# ;   ? [  ` $ S$ $ $* O$ $<;   ? @`  $ `@@ @   ? ,   *` $ @%$ $ ?"$ $ ?  2 "?<  2      ` @Ұ0? !0<3 *2 0L㿘   0?& ;<  &<   &   6   < @ @” <  .  㿐0  !0<3 j2 l?    *@ "70  & "20  +  ''' !?  L @ <q  @ޞ`60? !0<3 *㿘 ? ?ꀤ & 9? #;   < :$ & < :<$<  4   < @ @- <  ,  "& & 㿈0  !0<3 j2q l?    *@ "H0  & "C0  <  8'''' 0? , L @iH <r T @B@`쀢< @;@ : "&s0? !0<3 *2 0O,@O֐4@2 0OՐ@O@㿘   & & &`   "  2  $ $ $$`㿘 9  *,@`#<9 ??& H`cD@h`  ` 2"`$cD?  2ܠ?a 2 <9#D (*   "   H` @kh`@"" "@##D"㿘l ?7 / (*   @ / ??/   ` / 6`@ 2㿘0    !0<3 j27  s` l?   !V @4,` `-  `@    "Cl    ,@     E  €  ,`@@  ! `  @  "@ !  ,``@  ` @  "@  ,``@ " ` @  "@ &@   `  L! "&ː&0? !0<3 *x#`,'<; @  ? @ ` 怤 ?ꀢQ" cc@, @*`@*` '܀ Ͱ?l  4  2 , , ,Q  ?,  '''''`'<;@  ? @  2? @r 5䀦* <;  ?   @  2?  @V w5耦* <;  ?   @  2?  @; \5@5*` 4 , @/@,܀`*X@& ܢ   d@@A d/ * "* * <; @ <%@`  %` ` = `5@ /*5@ (*5@ !*W㿘   !@,# l    *@    E " €   * :  @`"4   4 `@ ؠ      JĶ!㿘0    !0<3 j2_ l`@G?ꀦ Q" @]  #?* 3 .`!  *  ?<; @  z` 6   2? "00? !0<3 *2 0Ā2 0㿘` O   <B?<B?!<&`  ``&  L9 !`$@2$  2    &  `Mo  2  > ?  &  L ! MZ   <B!x&` t ? B& `$@<B <Bc?!&`  ``&  K ! 2    &  `M'  2  > ?  &  Kϒ ! M   3 ? & -  K !( !&`  `` &  K ! L     &  K !  L   0 2     Ғ   `"?& & & ,&  <Bt" d" " " " ," " " " " $ԝ㿘`  <``( H`,]E`%`@  ` " & &`&` `  `  "`"`    㿘Ւ㿘` 㿘 2 0ڒ 0` @`K #`"  IK! 耦`P0  !0<3 j2 l?    *@   & @> ?Հ ?   ` `?@Ր̠0? !0<3 *8<;@  ?@ Ӕ    h?* 2  b?l?    , @   & Q  K?  G C@ <  8  1`Հ  @ 7'(c', " (" '7 %7<@?@ o    " 8<; ?@ X    }l? @   ,`@   & l  f? `b ^`h "` @2`"` @" `" $$2`x I? @ A??* : `&?<w ̓*` €  0   * <BЀ 2  ` <"А [ʔ   ?  8  ` `?@AˌP  p`%p `$ " `2    8 @ה H /Ր@?  p@`2 `$P  p`%p `$ " ` 2    8 @ H /Ր@  p@`2 `$㿘 ` p   $ @ђ " pl$""?2$ P H@ /'l'` '/>?<> /Ր@?''`p "2  $ )@ $$@2"? @ђ ےJJ̐ >`" $$  `p 2 $ 㿘 H@ .`$V 48 &5 .`%V "     ( " $  `,@,   @?&`, 6&`( &`( 2&` #&`,&` l &``&`㿘 H@| ` ".`%" .`%    .`%# &` .`$&`,&`&`( 㿘`$ "  `@  ` `? @㿘`$ "   ` @ @㿘 ,`(@ `, (@6 "  %  <0`% `? Z,    ``@ <B@ + ̀ "'   "   2  2 @     ٖ2  2  㿘`%   `?` @Z?@^ S pp  $  `    @  $   2 %`% 1   @k`"p'` ">pQ ?VH`j  $ @/  ``` `@@ "` <WB#耢 <` <W9 Ր㿘   @ @ߦ ϰ? ̀`% "*`p`p "&`p $  ?% ? >H``p 2 $`p s` $ "` @ `  `?"O %2 ,`( ,@&D`, ( @O@ $&`($ ( ,`,@6&`,$ ,`. `( &+ (`, 7"  &  -`@ ͒ `( $ (`,$ ,`%, %`<$ <`@$ @`D$ D `` @ `  `?2`%`  `% %@3@R 2 `,@'@E `,`%( `($,   㿘 H' 㿘  H@g`& `& ` & `$. $`%. %`(& (`,& ,`0& 0`4& 4`8& 8`<& <`@& @`D& D㿘<Bc&` &`" "c&@&`4`@㿘& ` "` "<B" "# 8`"@$ `  @@ " <U#耢 <  <U 㿐` <_ ` <a@ `$$<!<! <!(h " @2" @ <" $$<<!0!@@<@aP `%<`!h<!p<!x @q "<`a`(`,#\@c`<`@a` @Y#\㿐<B#̮' ] 3<a@%  "@ @ $6"@ה@$  6 `".-<g@Ҡ%  "@ @ $6"@@@$  " ` @ْ`2'&㿘 h "  @2 " @"   " $$2 㿘`h  @2`"` @"  `" $$2 2 0+㿘?#@?0  !0<3 j24 @b0`$!00  !0<3 j2# !<B#Ԁ2 <~ې# 2 0#Ԁ0? !0<3 *2 0ǀ2 0؝㿘 w?h P "   `"  @?Z   <Bc`?"`` " "  @9<B , (" "@  8&   8"`"& 8& < P    € P@o  P   `" @@ @ `@"<ؐ <a@qؔ" & <B#`c`<3"ؐ "`& X&  &<`@# @VU 㿘  @ 0 0@"@v     < "    ?   "`"& &  㿘<B` h<B#  " "@   ?$ #"`""P%#`?%`"" 2H " "  (" "@   $ ` 8" "$ 8$ <   P`?    € P@ɐ  P   `" @@ @ `@"<2 <a@˒@"@@?"%2%㿘<B#ؒ#؀   4 "`"c"""#c؀ ؐ؀W<B#  TL I`?"`" "@"" " "@  (" "  $   8"`"$ 8$ < P    € P@O  P   `" @@ @ `@"< <a@Q@ؐ؀   0 0@?`0`0   2؀  (         0 0 @`0`0񀢀 ؀ "  ( 㿘  0 0<B؂  `` &  & &` 00 2؀ ( ۸㿘0ϐ ?㿘`   <Bc@?㿘%<@  2`F    ?C  2 @@8  `@@`` ,@ $$ $ $ $ T ( &$  T 0$ T 0" $ ("& 0 ($ ,$ ($ $  $ $  $ $$  0$ 4$ 0 8$ <$ 8$ @`$ D`$ P$ H$ \` `8" "8` "`"㿘  <c<  h& T& 㿘<_0`<_4`,2  <_4 * @@`?耤.@ H' $`P "  D  @  D @@      &  &ְ?   <_#02`<_#,0<_ #4(@" 耢@@ <B" ", 2  㿘    8&   8"`"& 8& < P   € 0 @ 0  "`"& &  <_02` H<_ ,0  <_4 ( "" "`"㿘  2 <S#H ` " #`"`& "&`""&`&` (`( (``" "@ ``("`"@ `@@ @"&`@& @ ` & &`  D`D& D&`D H`H& H&`H`  0 0"`&`($" 0 `0`0" & ($"`0㿘h@ .@   @  /<cp@r  /.   D  / @&@ @`.@    D < @ 㿘h  ?  @&   ?$@?ް  <;  @    2?;  "  㿘` @  2` *`@@  &` P "  € e  `2`h <C h26  "  < "@ < "" # <` (㿐''H`<9#D@h` l  h'& l$#D ! `> H`#D@h` `2"`$#D!㿘<B<C`` j2  S `J. 2  @2D<`;<C)<B # " ,l2 '`" "#"`""%#  $ , h     `@l2   l $ ? #`͠`` 2` *㿘<B  I "A<`;<C)<B # " ,:l2b '`" "#"`""%#  $ , h     `@l2F   l $ ? #`͠2㿘 h G<<C j@2. @ 9%<B   "  ,@l@2 @'  " ""`& $ $  & ,@ h     `@l@2 @  l & ?O # π  *0Q4 㿘 H   " h h " &   " &  $`"& @& 㿘<C ` *  %<Cא?` j2  "$"@" <C``"`@ ?h 2 2 ?  #?"  " "# "" 㿈%<C ''''l2 <Bː#`<Ɣ,<B    "@   "" ""#"`  㿈''''Ԑ e㿈<_#8 ''''M-<_' #㿘!<C l2 q,㿘!<C<  a8r:<C  2[`<C *<R 0<C , i  6 l2 )<C h !  a@!!`h$ d$?$?`$ $ $`L$`X p" $$ % @!& l&& & & !& L& X``` &`"  n:`l2q <C  2`,< `O 0?$`" "@㿘  h2 2 "  & 㿘 @A  6 $ . & d& & ,& @7 !& L㿘<C` j2' <C  $  <C`""`??"`<B " & <C"` ," & h6 # , & &  & & *0. <B 㿘%<C@3`<C@`""`?"`<B "$ "`" " $$ &$ h <C4 $ $  $ $ *@€  l $ < #0# Y  " $ <C"<C $"` *@ C0 㿘<C` j2  !<C%<_ 02 *@ $ 0 # 2` *0?"``$ 0㿘<C j@2r @ `   &  *  㿘@2  <_* c@<C  l2P   ,  ؐ09㿘 Ӗ  h<_ @ 0(<C  j2# "`""  *<C h2  "@"" (㿘  h    2  <C `"<C@<C` l@2 @  ? & V $  " "@&&  ` " "& &     &  `" ,@@l@2 @2!    " "@& &   &  ,@l@2 @<C" & <C$ ``" "` 2 p <B "`#" & "" p "  !< ʠ  M  @"  !<   M   !<   M  L L  X@ :  <!  L Mf: X : @ :  <!X  L ML:  @(  !< m! M? *㿘 d 8 € <A0`"# < `"@"@h2@P$" " 2@`"@ `2` 㿘 h`" ` $% !`` (2 ""  h "<   h "<  <# & 09㿘@2  <_* c@<C  l2   B  ,  8   H l2 V $ ?   ;  & " "@&&   " "@& &  `"& & ,Tl2 <C" & <C&```" "` 2  <B"cc"& ""c  *20ŀ2 0,2 0K2 0g2 02 02 @0̀2 @0ۀ2 @02 092 0x2 02 02 012 0X2 02 0Ԁ2 0d2 @02 02 0؀20‐2 @02 @0$2 @062 022 0M2 0n㿘@"p?   &@2T`  T  !! `Y U`  ` (@ T  !! `A *! &@`T  !! `-`" (`T !T  !! `!` ;6`"  & " T  !! ` 㿘@```6 &``6 (`` & ,` `& 0`@`& 4``& 8" ` (T6 " 2 T  !! `2  " ;6 " 㿘< #@`&`&`a"&` h "  "  € 2 㿘L  &? 2 "<<Cp" d" 0" 8" 4 d<Cp`?㿘. / 0   0㿘 *`<J!0` 90 3 0p㿘 #@3?@/ `c !,`$@4#@` ? @` $ $ .`@$@*`@  㿘 & > /% 0   0B㿘` ` : <Jq!0dʐ0 Ē 0㿘#   N?@ K# @,`# @ 4#@@4? 1@, @2 ` :`  :@f  :@], @@ $$ $ 㿘/o0p "    yB 㿘/ <; @㿘<",` `<aL?    ??  ..`* & `"  " &? &&   ?&& ? && E ?&&  &  &  & ,&  & &  & \& $ & (& , & 0@& 4 & 8& < & @& D & H& L & P& T&`& ?&?&?&p" D;;#&<  @!`'@40   &p "`L "H3;#'<   @`@    'p"`P㿘  ?* 2 'L    ?  ` d  ` *  ,* 2  *p   q  v q?l    -@ " ,  %  ,H @ 2A` `@ `( `2   `"`( o y ` p` /`#@wِ|,`  "@ `  8`  , ` |o 0'    w L" 3㿘p "`,  p"`4 p"`< ! ?!  ! 00" 0- ! ` !   #@ # @     wn л  / p   w^  ئ'H  ''T 'P ' ?''''' '$'(','0'' 'X<"OJ"@ ` OJ@ ` JOÐ" А?* 2  Ҁ   `d " "  yꀢ 2쀢`rh@Ɛ @  h? ܔ@  l Ւ fl    / @"'L  & 'L?L@ 'H'D'@z  2r쀥 :?`6@3   5?   '<*?b @ଐ <b8@ঐ 2< <` !<X !X  !X  !<M    Θ  '' ''''' '$'(','0'?h'p't'x'|'''`@ 0j! !  2  2<JO@` OJ@ ` JO" ?<Fΐ"P  2<bx`@[`  '\\ ά $$`$$ { v`p"`4p" ,p"@ ?! !X!Xp" T $p"`@Ф< !<@?@ Y  Q `@ `2`2 `P "@ `@  0 o #@ uP` 'PА" 'TT" @'TH@ 'HL@@ 8'L D *'D@ *'@@8 `@ !< L@H@D@'L@'H'D '@hɒXC <F"ge| a_"3 `` ` @ ` "H `   `@H ` "CX!<C Ȁ`!H  `` `@S ` "H `` ` @@H ` "@ ?! $(X@ #\#`  T $ *Β] 2 pp``D @̠ $`DpL "<"8pD",pH"(p@"4pm"@zLX @ H    t H  ## # #  ; ; ; ; (; 0; 8; @# H# L  *z  j  fX l   ? ? l+  @ ``  $` ` `!<`  4?? 4!< |<J""O   OJ@ ` JOÐ" fЀ c쀢`Ҁ ] d Y `TR* j  L?ܗ*i  ?  *`" *0 2    o  #@ p s(  p @ 8   @o p "    s֚  [㿘 !  `L@   `?   `L@?!㿘  >`   @" 0>`>  㿘@   ?  ?㿈@} ' '' 耢 ``Œ     `` @  \   (- p   : @ :    p*!\`< @$b ///@뿒  4   777'7''''7777<<b!<@ b/!<8!<  R$`"<  ڐd "֐ Ґ  `̀3 "! 4 ,` 4p@s |@p . !<:` "''p't'h'l7 d''`'|'x `''d''l''@3'@y d* @*`"@*`@*`'@$ d'@j d* @*`"@*`@*`'@ d'@[ d* @*`"@*`@*`'@ d'@L d* @*`"@*`@*`'ĢȒ` @@p?!<`H;     @G @!<@$``$``$`` $`$`$`'x | p'|''   8 2  `` /p<" /q ./qOq Z`?/r ?/s't7x7zp!< H`D"`O4 Op`  D< @@   J ", &J ,!< @֐ &''"'' '`  !''''  hd@?` T 'T'P@'X'\'`'d'h'lP   o,p `A! ` `'P'T"@`'\'X`       `?   'd'`` * 'h` @ `'h` h 'h v'lʔ "p` `2`  h ` `!<ِ Wp`J ``  @  c   @`? "4` ``@:/` 8@@]@[ "3!<@V ".!<@Q  @2 $ "p $m `&p@*@` `2` @<"AӔ !<0.[@0f@? @ 2?! 2?!  $!$! , @  " *  J  2L *L  J " "J 2'p^? 'tJ@x !, p /'pJ   J J "* "*J 2't@u)! M !$$!t ` $!$t @ !$$!`$!$! 6 !$$!  $!$  < $!  㿘j?㿘.`: :  @.` >`@  @ < JB 2< J=  .@< .@  T@ !! `? [[Y[[[[[[[ZYԝ㿘 &?<;@  @  ? `? <a #@,  6 y? u? o? , 0@  .# c? _?/ $ <C<C@" "@ 4 ,  4 .-  7?`& ?< @ @ &@,   ? <6&&#&   2 $ "$ b (4 2 #.k$  !" . ,%%!"4 ,4 .㿘   <ac@* @ 2???  !$  3  ( "#`  2`   @& 2 @$ `e(T` "h? 8 @   @<$ <C<C $7; .@<<C<C $7;0""2" @"$  .*` 4 .$ $ # $ b #4 4T`" `? ,# "-4 ,<@:?`&@ 2?  `<@`@ 2?0 2 ? 2?.ڐ (T 㿘0  !0<3 j2 0? !0<3 *㿘0  !0<3 j2k  0? !0<3 *㿘<C!  <a#@,? ?%<Cc@.@??"  ,?㿘+<ac@   >??"@ 8   ac@"@<C!- #.?4 $<C4 4 a<4 4 4 04 $ $ $ $$ (4 .4 ,4 44 2$ $ <C # $ " <Cc@`""<C!, # . 㿘0  !0<3 j2  y? fb?&<a?#@.   .` ?:`~ " ?* 0? !0<3 *㿘<ac@.  `<C<C<C``,  4`" 0  <C ?*  # a. c@?" #a`$ ` ,o #`$,l #*`(  @ ``(`$  @ ``(`  1<C!&! !@0  ?!0<3 j2F -`+` ?<"t*` €< /ؖ( '''''7` ' '<Ca<C<C' ''<; ?@   20<C! <C! ?<a#@,  !$ ߰? ;* ' ' ' ' ' ' ' ,7 .7 07 27 47< ?@ה 8  8 "0"0<; @Ô 8  8 "0 <a#@,`   ? 4@?`";``o?0?W!$ ~?;' ' ' ' ' ' ' ,7 .7 07 27 47< ?@y 8  8 "V U0? @ T@ !! `"@0@@T@ !! `"/0?4 0Ĕ4 <4 ̰  a  4 $ ? @ T@ !! `"0n 0? !0<3 *2 0w2 02 02 0lm\nnnnnnnnnnknnlxmiij8jj j`kLkDkkkkkkkkiiiiij@jĝ㿘<C!  <b!@,? ?%<Ca@+@??"  ,?㿘`<CX?@!@ /<b@     `B?.`a`,?"%a   a@"@"%a<C!*m #*?@= ,4 $ $<Ca$4 4  4 4 <C<4 $ 4 (!  $ #! <C@`"<C"!*F # . 㿘0  ?!0<3 j2 `.  e ?&<b?!@,`  (@ 4 0.:`ڐ ? * 0? !0<3 *㿘.(,;@ (P`@@2(`( &@&@`" @@` ( 6@ 4?ނ`@*@   < %" ` ?@ ;@ . P`@@ &@V&`" @` . @`6@@:@㿘  +  #     $ 4 ) !`2   $  $  $ "@` "`& $  2   *` 2` 2 P6"  2   *` 2` 2 P2"  2 㿘<ba@. @  <C<C<C$` (  4 " 0$  <C ?*  # ?a@. " a $?`#a?"```2"`   ?& &  ( ! 2& 1H0      ?!0<3 j2H `ڀ`؀ր9<C<bgd<b#!    '''''''̀'''<C<C!a''<; ?@譔 (  ( 20<C! ! @ <b!@,`  O!$ ? ;* ' ' ' ' ' ' (7<  ?@x ,  , "kj0 `!@,   `?4`  (@Y?    @L? .`@<#. €!$ ;?`p<#*` €0@`?#+ @.`2`%.`ϓ2`V#?O!@ @ T@ !! `?̐ @? <;  @ 20`  *R` *!@< ; ?Ȓ@֔ ,  , 20!@, ð? 20`<"*` €s!$ ? ( ,` *  *3@  (&   ?<;   @皒_ \ L ? $ <.` 2 2 s%@ @ T@ !! `g??4 Ζ4 < a  4  V$ !$ P?;' ' ' ' ' ' (7<  ?@? ,  , 2300  *?  <Б**  "  $"c : *  2  ce$  ??0? !0<3 *㿘@ " 2+"@0   <8#㾰0  ?   !0<3 j2> ǀŀ ð?.? 8<;@ @ 20 <b!@*` ??ꀤ?4 @?@* ?値 (@ :0` 2`R` &  4 `@ *@?!$ A 2z0`* Ԁ2@~```2` ( *  ߐ Y?@ `&` &`&@! $&`$ $`D ?'(','0'`' '4 ! '"$  '  ?$  "$ " ?'$''a$ ` ?'$ "!!"@`"`$ ' "0e0? !0<3 *㿘؀``"!`@"@`"" "`!آ@ G<b!@'< ?9 * `22@2/$  $"     (7 &!Ԇ "@( <( (R @ @  #@ #@ `## $@@ 2 !ԁ2 0Q2 02 0~|}}~~~~~~~~}4|㿘<C!4 <b#@,? ?%<Cc@' 8@??"44,?㿐: p?<C( <CaL 6g?+<bc@     Y??"@ <   c@"@<C!8%  #J?~Α,  $ 4c@"@<C!8% #`;?@S a<C <C* 4"@ (%($4 <C4 4 !<4 4 4 $ b4 $ 84 $4 "$ $ <!4# $ $ 0#!4aHc@ "@#aH<C!8$ْ # . 㿘p` @g90  !0<3 j26 `.<C!T@ 6?ꀤ  ?? %?Y&<b?#@.   " ?@. ?:`Z " ?* 0? !0<3 *p `@㿘<b#@.   <$#H <C<C<C!< H44 ?3!<#  H4 ?*   4 4 <#x6/0- 0 @"-<C8)<C'<C 4,`@"`@u  @pw !,?%!,0?$0`@ 4} ("@c%(80  ?!0<3 j2 `(&`` <; ?Ȓ@  0  0 20` M<C``<bl <bh ?<C<C!T aL '''''<; @ߔ $ ! <CaH<C,<C(''<C<C<C!0'a@'D''<;?@㿔    20<C!4!4 °?<b#@,  a!$ 20 ;<*  @ ?@㘔 0  0 "0#@,`   ? 4@?` < x.` €T@? !! `"0 $z? ;v4 T@? !! `"j0 $e?$a4 !$ \?<; ?@B 0  0 2M0J  @ T@ !! `5??4 Ζ4 < a  4 $$  @ T@ !! `? $ $"`4 r ? 0? !0<3 *㿘  g"@  c  " p X*` @ @?p2 `X p "XphE ph 㿘p`? @='0  !0<3 j2$ `*<b `#@-  `! Q<20?`d <#`<",  /?g`0c`0?#\`0W`?<",   /?#   <",   p? @? @ @#`<",  /?#`0`0?#`0  <",  p??@`0<* ?ꀢ@" 80p @  @* "@ 802`ep `@( `2t0?!!$ 2i0`5`c?<c   [?@-  @ c`cM?-  &`4&``0* &`p&@  &`$ݐ$6`<C!X&`(&`0&`,`$?*2 a 4`$ "`8`$?* `4`$` "ccf0 &` `8` "`$$`8`8&`$b<4`"$`&0? !0<3 *p `@ߞ㿘 4<b2 c@*@2$<#35 0*` 2$2$8 & 8 "`$"88& $<c"b2"㿘 4<b2` ` #@+`  $"$ < $"b $3 "?* # `3 $ " 㿘p `@⟞0  !0<3 j2 p`<C!X`( ` ``,"2` e1"@`2`(0? !0<3 *p `@Tu  㿘 4<b2  !c@@  ,&@ @ 06` @]  4.`@@} 2< 1 @݊ 2 4G?@} @  4@}ؐ ے <Ca0?"a0<C, ",`@}@} 4"@?!`@}!<" 2 * @<<cЃ(`@` @@}㿘<Ca, @  J   "r <C<b#@*`    )<C $!<Ca4  %!$က)$ ! 0 %! 4*@@}l `<C@}e<" 2 * <<@Г*`@ `!<Ca@ "a@h- @}M<" 2 * @<<Г*`@`@ :  ! 4@}8"@ @}29 <C<CD !0,`?"D#!0%,㿘`@}@}.`<& 6 <<cЃ.@(` 4@ `"@ @I<C,`",<Ca0?"a0㿘<b#@  ` (`0 @<b#@+` 4@ 2 0  Ô0 `@*Ë@2 0ŝː@2 0sʐՋ@2 0ם@_@2 0a@<H$$$X4`hhh444\|x x x```$@@͜TTр˨̐dʈ 4 ʐʐʐ`@x4<Xx```DhxhhLLLTdT@@0@P@,,l`@  P  P  X\4x4<DH4<DHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHLHHHHHHHHHHHHHHHHHHHHHTHTHTHTHHHHHHHHHHHHHHHHHHHHHHHHHHHHH\HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHdHlt|HH㿘e   ;<   `?`&e0@&e ! `$ $  ee , @ e0@e 2  ?e# @&ee *@&e&e'D0~ h'L'H '8'D0F<(?!=!;!9!x7!5!3!1!/ x-!h+!)!'!m%!#!p!! h p!H! H jD2  <(   H# p@D(3"@  2 L `@"@"HL(@ 'DD>`>L?   0'D''''0&'@@' ?(0&`?.`( ".` @?'@'HD   80880220 2202FE    80880220 2202#` `  _  80880220 2202``` `"8+& ` D  />+&@ .&@?"D `>+"  / .@0( "?.( "&@. @? '@'H 'H  'H 'L?`0('`0'\f, 4`,`\D<'\p'd  4@,M,@c "?  84 8?802?20 2?202#?"?@  @84`8?802?20 2?202? ? `?,@ \'dD '\D 'dj> e'd b' _'HD 'd`Y>D '`S>L?0('0'8 @-`D'' =>`?@  @85`8?802?20 2?202?? -@D ''>D `' > @' '  LD`H !HL-   @ DL>' D6>6' L?   0'8''''0&'4@' ذ?(0&`?؇.`( " .` 4?@'4'<C   80880220 2202FE    80880220 2202#` `  _  80880220 2202``` `"8+&  D >' 06 ز +&@ .&@?#D >' 6`+"   / @.@0("@?؇.("؅. 4? '4'< '<  '<L? (0g0gh*3 + |D>' 'Xѧ2`  3*M+ f"?   82880220 2202#"   83 880220 2202` ` + D|> ' 'Xw3D> ' 'Xo6` j'Xf' c'<D> ' 'X\0D> ' '|U2`?(00'x: @+`D>'x' '|@6 `? @  @83`8?802?20 2?202?? +@x>' D 'x'|6D> ' `'| 7`@ '|' )  D(6 D"6H`@ "@H` #H`&L(@'D6"<L(|. < (x   ` -@@ 5@2 x'l  ` +@@ 3@2 'l't@ 'h@'pl `5` 'h'l@ 'p'h0'p@'p 'th?#@'h'ph  h82 8?802?20 2?202??l"@'lh+'h@@2'p'h'p'p'h 't'l'h'p'tx'l|'h'pz't 'pq't 'pm't0@'p'p `'tdX/` <̇(\@#` `8`  @ ,4@  ,@,4@@ 4"''L  #'L`8 `  @ * 2@  +*3@ 2\  \'L`'T@ D @'P1 ) 1L`'L`@ d 'P0'P'P 'Tb'P"?  81880220 2202#"  81 880220 2202` L `7'L 2'P`'P'P   'T\'L`d'P|'T'LX  'Pu'T`` 'Pl'T 'Ph'T`0'P`'P ['TH<+ <(@4@o  t\耦  8.&    .``@.``(    @-`..``&@  `   @...`( 0`'@.`0"`` .``` 耠 @ ' ''''4n'(j t\؀  8.&   @ ذ .``@@.``(@   @-`.  .``&@  `   @.  ..`(0`'@.`0"`` ؆ .``` ؀ @ ' ''''@'(D'08>D',ظB@'''@V'0(( `  0(&Բ.`0``" .``` Ȁ@ '.'(',؆b@'''Ԇ',08',D',  '0` ԰@@b ''''8',Ԁ!?  808?802?20 2?202J?I?Ѐ   808?802?20 2?202?& ̀" _?  808?802?20 2?202? `?( '(  8/ & `  @+ȴ / & .`&@?` @ȇ/ "   ..`0(#@ȇ.`("`Uȅ.` P @ D'','' ''8','''Ԓ 0'0@'(D'',''!H4 ;'(D8?D ','08 ','0D08@',D', '0|2|( <L(x@   ` -@@ 5@2 x'l  ` +@@ 3@2 'l't@ 'h@'pl `5`'h'l@ 'p'h0'p@'p 'th`?#@'h'ph  h838?802?20 2?202??l&@'lh.z'h@@2'p'h'p'p'h k't'l'h'pc'tx'l|'h'p\'t 'pS't 'pO't0@'p'p B'tX 2dX*`Ͱ < (\#` `8`  @ ,4@  ,@,4@@ 4"''L  #'L`8 `  @ * 2@  +*3@ 2\  \'L`'T@ D @'P1 ) 1L'L`@ d 'P0'P@'P 'Tb'P"?  81880220 2202#"  81 880220 2202` zL"@`'L 2'P`'P'P   c'T\'L`d'PZ'T'LX   `` 'PL'T 'PH'T`0 'P`'P ;'T<8'8HD',ض@B@'''@0'0((   0(&Բ.`0``" .``` Ȁ@ ''(',؆b@'''Ԇ',08 ',D ', '0` ԰@@b ''''8',Ԁ!?  808?802?20 2?202J?I?Ѐ   808?802?20 2?202?& ̀" _?  808?802?20 2?202? `?l(&'(  8/ & `  @+ȴ / & .`&@?` @ȇ/ "   ..`0(#@ȇ.`("`/ȅ.` * @z'@'('D',''H''04'(8'',''<''0D8D  8 ','0D08 @',D', '0|.@s'p<('tx`'l;` @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@. (0@ ['h'l@@2'p'h'p'p'h 't'p'h't'p|'h't `'h'p'ty'4`,`'\'d'` 3 + x|'XdX+`@'P<L(\'T'L;  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@:  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@: @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@''';   @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@@''''   .```.` (          0( & IJ.`0&`` .``` @ '@)1  e1La'L 2'P`'P'P   P'T`'PdI'T'PX  C'T'''' ذ??(0&`?.`( ".` \d'@`'H'D''''  ??(0&`?؇.`( " .` X'4'<'8H<(D8@',< (@'04'(؁?` @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@܁:` @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@쨆@ @ ?`  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@'ƀ @:`  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ @ ': @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@@''?`  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@''<  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@ '' ?`  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@@'':  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@'' @'':`  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@'''@@''':  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@'' @ '''''<   @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@ :`  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ @@'<   @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@' @ '' :  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@''€@ <   @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@C '''''''''    .```.`(             0( & .`0#``  .``` @ ''''@&'Ԅ(   @?`0(&@`԰. 0  " .    Ȁ@  '( '( @ 'D'',' ''8','''Ԅ  '0D','H'0'8','<v'0?? `''','0'' q'|.@'p<̇('tx @ 'l'l5`-`5`-`  @`  ` > @  8'h@@2'p'h'p'p'h  )'t'h'p #'t|'p'h 't  't'  'tdX* ` 'P<(\'T& 'L L@  , 4`,`4 'L 3 *+  & F`  & & `& 9;   @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@B  @Bf  P & F`  & & `& 9 ;   @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ `B ?  @B?2 / " - *  2'P`'P'P    'T`d'P 'TX'P   'T  'T'  'T 'P'T? 'H<. D8',<L(@'04'@'(''''8(1(܀ *(؀%(('ؖȘ  @?`0(&@`. 0  ".     ؆'(Ș  ?( 0&`?؇.`(  " .`  4?"   b@''''@g@'''@D'?" 趆@B@'''1'+` @ '@G@`@  '@'@@`'@8"'؁8 @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@''܁8@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@F`''8@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@F`'''''2c8  2^8 2YV " 萃@F '''@'2=􀠀8 2883 18 )8 #쀠8  耠 " 趆@B@''''@f '''`'2Ȁ2ȀȀ@" $􀠀Ͳ+`?"`  @ 'D'',' ''8','''԰ '0'D',''H''0'8',''<''0 '0' '0?? ''','0'''|  | `` 'h'p'tp 'p't'p'tr'px't+`x 8'l'h h#@'h0+`` h`'hh'hX  X x` `r   'Pm'T@ 'Pg'T'Pd'TB'P`'T*3 + 8`'L    1 @ *"*3 6  + 1 @ 2 * 8 *@b*3 6  +  +@ * 2'  :$  ! <`!8<` 8ز 8'','0'''8 ','0 ','0',4'0:  ش @(0&@؇.( " . '(''''''''    '԰& '''Բ  ?(0&`?؇.`( & .` 2   '@ '2 8  @'g ''''  ?(0&`?؇.`( '@ .` 2   ''䀠 '2& * 2  ܀@ @ @̄@ ''''f@'''ܲ  ?(0&`?؇.`( "@ .` 2   '''䀠'2422.2܀8 2(2؀ $2 @@ @@''''ض@ g@''''Ȅ 'ȵ2  ?(0&`?؇.`( # .` @ Ȅ'Ȅ'# (& &@|"'$| x  `<x ?`s'$x+@x  +@  @ 3@``'3`Y'$ U'$X"Q'$X `K`G  `S' `7  '$5'ɀ'+% +*3@ 2`6 6 `` *   2@  `'3 *'$ '$< "'$<  4` 4''$` 4 8 '$'`sC8/   `  @*/ ؄& .`&@?` @؇/ "   ..`0(#@؇.`("`&؆؅.` 4r}؄ r 8.     @ ش .``@@.``(@   @-`.   .``&@  `   @.    ..`(0`'@.`0"`` ؆ .``` ؀ @ ' '    0(& .`0``" .``` '$8 '$ P'$5 'p't '$?$ 'l 'l$@82`l'l80l?'l20 l'l20l'll   'l$ ; /@?@@ '$l $(*'h'$ h *@'h 't'p F'$5 'P 'T '$?$ 'L 'L$86L'L80L?'L20 L'L20L'LL   $('L.@ 7  '$L  )x  'Tt'P '$5 ',`'0 '$?$ '( '($83(?'(80('(20 ('(20('((  $ (('('$''''Ԅ s   8/ & `  @+ȴ / & .`&@?` @ȇ/ "   ..`0(#@ȇ.`("`ȅ.`  '0', 1 ) x'L'T'P''''̲ Ȱ??(0&`?ȇ.`( " .` x',|'('0''''в Ȱ??(0&`?ȇ.`( " .` X'('0',X + 3 *@ 3 *'h'lX'p't<`=ذ    .```.`(           0(& .`0"`` ؆ .``` ؀@ 'ش   `?` 0(&@`. 0  " .    'h4<'l8't*'p<=ذ    .```.`(           0(& .`0"`` ؆ .``` ؀@ 'ش   `?`0(&@`. 0  " .    4<'L8'T'P00`''0 0'x`   x` X'$ `? `?2H'$ ?`A'$ >'$ 8'$?5'$ .'$?+'$x #'$? '$x@ @?'$ '$ '$? '$@ ?'$ '$'$$2Q !U   ` @`?x`  ` @`?"2-' 00g'`'\ 0gg0   \` _'$`  `?\` `?2M'$ `?F'$ C'$ ='$?:'$` 3'$?0'$\@  )'$?&'$\@ ?'$ '$   '$?'$?2 '$@ ('$'$ '$$2 !V\'   `?g   `?"`' 'h'p't' ?'P'Ty'?'''̄  '','0l' 'h'p'tc' 1)\) `?'P'TS'?? ''''','0F'h`7`@'h>?'h 'p't4' `'h+'t  'P'T?"' 'T?'?? `''','0'' '??'''̄'Ԅ '0'L?1)1?@#` 0``0@'D'''''@ '0 0'8  @'''䀢@'4@  @2 4@ '$4  `?@`  `?2u'$ ?Dn'$ k'$88D `'$?]'$4@  8 T'$?Q'$4@ 8?`G'$ D'$@8쀠  耠 8 `$'$?!'$882'$882'$܀8 82'$؀ 8?`'$ '$'$$`21 !W)@   `?`4   `?`"`'0^  Y<,($Q$M&t`"'lt` 6〠6lg'lh `'6""h  phh 'hp  h` 'hh`'hhl0 'h'lh2`'hl6p t t  't` t 'tp` 'tt  'l'h?'l'h 'l D'll h /@@ 7@'h'6"h  ph'hp  h` 'hh 'hh@ 'l?'hh'l7`'h7'h#'l 'h`6'   h0  'hp   'hp 'hh0'h' 'h 'l'hh@ 'h'l6O?@h.l(. p (/`;&@T"'LT 66L# y'L `'6"&@ @ @ AP @ A P@ A@ )1 1L'L)1 1L6P T T  'T` T 'TP  'TT'''L  'L?? 'L ))1@ 1L 8F'L @ )ဠ1@   '6"&    AP A P A  5'L'L1 ))1&'L  6'  P1 L F`P2 1  FL B 1 ` '''L  ''L6*?L)P(.  (/`&&0"'(0 (ހ '(Ȇ``'6"> $,6Ԅ`1и̴Զ ƀF"," и̴Զ ƀF и̴Զ ƀF'''' (`   0(&ԇ.`0``" .``` '(   @?`0(&@`ԇ. 0  " .    ([0, 0` 0`  '0` 0 '0, '00` '(''' 'Ȇ?'('''' ''( `t'(` 8(. &   @ ȴ .``@@.``(@   @-`.   .``&@  `   @ԅ.    ..`(0`'@ԇ.`0"`` Ȇ .``` Ȁ @ `''0"> $,6Ԅ`1и̴Զ ƀF",`" и̴Զ ƀFԸ̲ж F@'''' o'('(     0(& ԇ.`0``" .``` [''(ЄԄ? ''''`'0"1 *0(`@, `ƀ@,(`@@''''ȅ0'''('''' 1#'('05?1" (" д*@" ֵ.2  ,.@.+" H0 . @@ 6`?          2 @. @@H&`? 2@ *@*@ 2   㿘` "<  ( ` h ` `??" "29? &@4 1 ( 24   "( T  !! ``  < "  ?T  !! ` ?㿘 h@ <<cȔ@"   d@5@ t,`@  <<cȔ(@!  $&+`@㿘ϔ  ??# ?*  *@2@ 2@  °  .<<`x@!Ŗ?."@"㿘 h@  <<`Д@"" .`  `   @<<`Д@! YW z        *@26  z * @ ܘ   ?" " & $&  z  6 z " z( z?  +  ܔܘ?"" Z 㿐 h 2 < !0r  > . ? ! pc ? * * 2` 2 @ ? @ @ @*`* @ 2 2`   0<<a8P@!8 0 !?# #? ** 2` 2  T@ &@  @ @*`, 4`2`  T@&@ T@@ "@& z "  h 2 h ܀   h  ,  @  `*  @ ? *  @' " K?# ?* *@ 2 @2@ ?@ @?@0< *  *` 2  2  ?< * *` 2 2 @ ? \?@( <@   \?@ <<a8@ ˘ @?#/<-<'?@` $8` @( @'2  8@ $   2`*     2`*  4  *`*  2 2  * * 2` 2 %     @2  l}j  ( " l} l  @t }X  ( }  @b2  }G `( " }     @|` x @δ . !.  #㿐?' h2 <j!   ,? !p` ?`   ( (+ *@  23`@  00@@0@"` "Tp 2`T@@ !! `0`?# ?* * @ 2 @2@ @ ?` @ @*`* @ 2 2` @*??# 1?*+   2`3   T@v&@ , {#?  * 2` "1h` @ @*`* @ 22`  T@=&@z` 2h܀  h  , @ `R* @ ? 9<`*  $ `'  * `m`?4` ?*`@  `` @ " ??2c ? **` 2 2 `?2?  ?( `23?# ? * + @23 @ ?@ * @?   2  ` ?# ?*  + @2@ 3 @  2  ` @><`T $"@`2`@ `$T" * 4`* @  ``  " ??2c ? **` 2 2 `?1?  @?'` 2@2?# ? * + @23 @ ?@ *@?   2  ?# ?*  + @2@ 3 @  2   âh  ?# :  4?  * 2` h   :'z  ܀   , @ `* @ ? &?*  T$'@ɓ2``$T" * @ U  @   C?  ( ??` 23 ??#  ** @22@ ?@ * @ @  2  `@ ?# ?*  *@2@ 2@  2  `@ @ <<b 0@]    `  $;  @  * " T@`?c ?+  *2@ @ 3 @ @?8  @*` @* 2 @  2` $<  @*` @* 2 @  2` <  *` *  2 2  \@? <<b `@n<`$ ` @ (@ <<b @s`Z V `̘     %&T`    2 `$:` `@+@2  &`  T@* ?# 2`*  ?" 2`*  5 ` ? **2 @ @2@ "@ @ @ *`+  3` 2` %`   @2  y `( " z     @` "`u% `?c ? **` 2 2  <<b @WyP  '<<b @G `2`"t`$@ }0   @ y  ( yÐ " y ?c * 2 ? * 2` 5   @|2 ` y`  ( "` y` ? ? + *2 @ @3 @  @ @ *`* 3` 2` %` l  @R  y6  (  yr ,!, # '?'!, #  p?  @? @*`(02` 㿘 "    @d 2 @㿘     2  ݒ   㿈    .  ' ! p' h d @? 0'쀢'?#7?;?G  z "  h 2 h ܀   h  ,  @  `*  @ ? ײ*  ! @ "+ p$ ` << c@ @ +<)<`$<  -  c#H@@ ` p   @ *` @+ * ( 0 @2`3`   2 $"@ T:  ,@ 2  p<<x@Җ p  @ *` @+ * ( 0 @2`3`   2 $"@ T:  ,@ 2  \<<c@ \ @5?#)?5<-< p` * *  @* 3` (2@ 3  @  2@ "@$@ T:   *@@ 2  \ؖ@v \`@* p @<  * 2`  <<`@]' h ? # ? ** @2@ 2@ <<cX @=!.  #    <C $ @ 0(*   ?㿈?# @ `*`2 @  <; <6  ?`<-  `$`h&`  <!!`?`h pc?   ( (*`+   23`  00<!  ??# *  ( @ @2 ``@ 3 `h0+`@ @<#\#`#d8@`?P  `h    ? @7<@T    @  `< @  "B> 2; T  ?:@   @ C "?  ,`" `"?w2 ? 4` @  ,   w,  T`D@*   ? $#`  * 2` $       @  @ > `D& T?F#ᐢ@ 2@  ?  B > vҐZ?`  **3  *`3`@  2   T ``  &  T2 T` + 3` B> ` `,:  4      * $  v``,:  4  8 X `    + ,: `@C+ 3`@; ??`<3`@  8` `( `T  ` 'P   <!?h` ?"<   <<a@ q? *`*h2 "`$T  !! `2 `$"* `4"J`$  ,P <ĖE?c<pc :?p#@ "@   '?"`  4`  `< t"'l7;l@ ”  'p "tԀ@8`   `` @`?`2p `@I`$` <@ @` $@ @ p  @K 0{ #Bpx p  @> 0n #2`p `p  @Bpp`  pQ p` 2 p` ua "u?t``$ <@ @X$@$@` pp  uC "W?V  @ܞ pt ( ptp $5`$@&@p-x" p  u    @ ڔxx  @`  o @` " `"?t ?` ` $ <x @  @` `o @`"?tѐ ?`,4$,`$@<?4P$8$4:㿘` @  !  `? 㿘 " `* (@ T  !! `  " * `6 "Ő㿐@?# ? ** @2@ 2@ "F  h r} 5'􀦠`   "oB `  `)?tR %?     ` o#   t7   @  ` ?"` 㿘&@?# ? ** @22@ @  2  h  t/? & 㿘   2 㿐ǖ #   h` 2 @ .` $@ ] 2 h`` 2 @ 􀢠s͐ 㿐 #   h` 2 @ .` $@  2 h`` 2 @ 􀢠s 㿐m #   h` 2 @ .` $@  2 h`` 2 @ 􀢠ss 㿘`< "( @@   @   Ф Ԣ ؒV@b@@  @@ @ ?㿘T    ?# ?*  *@2@ 2 @ sH  . <<b(@K?. | "@"㿘 h@  <<bp@ x   |2  h " hu  h .`  `  | @"h<<bp@А [Y(2  2  |  |   *@2(2 6  x |* @    ?" " & |$&  x  6 x " xr x?  +  ܘ?"" J 㿐  h<\"0 `<U# 0V $`<N#H0値2 <G#p0ހ  { ,`! p?# ? ** 2` 2 ( X<<c@r@@{# < " @*@  `?'  $<  @( @+ <<cؔ@`% `  2`*     * 2` 2  2`*  ?  * 2` 2  @2 qp  ( "q? ? + *2 @ @3 @ ` @ @ *`* 3` 2` %l  @b qF  ( q  @P2  q5 `( " qp     @ j`  ly  ,0!,{ #㿐 U$ ǐ? 2h?& & h `  z ,``0 !`p<@? & A ?# ? **2`  2`h@ `h _ " `h   * 2`  "   @  ` *`2* 2@  @$`h `h ڐX  2  ? # @ `*`2 @"`h  `h  ?# :$  " `h   * 2` 2 `h, * # `h  ?# :  " `h   * 2` 2 `h * ː * ! #,`?&s `@ `X$@ ' C?  ( ??` 23 ??#  ** @22@ ?@ * @ @  2  `@ ?# ?*  *@2@ 2@  2  `@ 8<$  @ (@R <<` @9< @2 `  oՒ `( "` p `    @ ` "`Xk `X ?# @ `*`2 @<<@`@P#`X@a@ ?# ? ** 2` 2 ( <<h`@.! #,` < 2`*  ? 2`*  @  5   2`*    * 2` 5   @s2 oW  ( "o? ? + *2 @ @3 @  @ @ *`* 3` 2` %`l  @I  o-  (  oi ,` 6 $6 "& h`6 6 &` ""($ <(@ @ 6 (d 6 (& <& & @!<#  & 4&!& 8& 0<@( & ܐ &  & & . . & & & & d  & <C  & `" !,`7 #& p? @? @*`(02` 㿘   xh .  `! h  p, 0?#-<+<1  *   X  2``  * 2` `Ж@, h ݐ ?# ? ** @2@ 2@ <<`@!. ˒ #㿘@2㿘 (  $ "<# &  ` &  h   2  2 @ @`& ,@P$㿘! ! &!*!2㿘 h ` "!wː !G!@ " ` ?  h&!&! m 2 ` h<<aXp@? 2 h " hiL h @'`$q ` @ `m `( `n`nI "<  !!  㿘 h ! * * ` 2`<< a@0/` 4&* @6&@ &&" @ 6 &@ ?@>@  &&& >@ @ <?>@ @  & &&& < a@Ӕ㿈 4`* ?c ? ** 2` 2$ ! `h m`  ?$* @  **@ 3 @ 2m@  2`h0 㿘`h.` `2 @   ?# ?*  , @2`h@ 4  @ l`  0P?倦'} ?# ?*  *@2@ 2@`"a$ `, @栄?, 2`h T@a``h?`p`? + *@ 2@ 3 @   Ē`h lt`   /  "m9?c ?*` ,  2 4  $`@$`$a<#@`h$`8$`@  ` `怢 "`@0 M㿘`h  \2` 'H  H  @ĔHH`  gӐ H`  H` l ݰ . $@ ?# %?* *@ 2 @2@ '?H k @ @*`* @2 2` g H?倦%H  lH?`$# ?  ** @2@ 2 @ `"a` H $, @ *  *` 2  2 ֠?`H  2HH m loᤒ k?c ?+  * 2` 3 ?  H  "ylRu *`,   2 2` %H `@2 `hkƒ `( "`hl`h "`   `  `怢    @HH` <f <#`@$`8`@ $`@PH$a$` l㿀є? #&  @?!&  &!?&< ` @#\ך?2 h  㿐 @̖ J'􀦠-< "  2( @($ ha "`p  `̀6@  ' kk  h p `̀     @e` ft    ?k?& 㿘  ( h h!@  h? p#@/? * * 2` 2 @  +?<< a@ 0 X@ h@ <<a@ z0!  t6@*  d @ <<a@ i0@x ha@2$,   @**` @ 2 @ `2`  4  ` k> 2  h<< ha @ A0]` $?   * 2` 6 "   2`*  6 &  @ `2 *`@6 (   2`*  6 $  @**` @ 2 @ 2` & ,  @**` @ 2 @ 2` & 0 @**` @ 2 @ 2` & 8  @**` @ 2 @ 2` & 4  @*  @*` @2 2`  &  j0& < ?#? *`* <3 2! 2 & @`#!& D d *`*  !2 2 *@ & &! < **  2` 2 &  p **  2` 2 & t?. u6 .  h *`*  2 " 2 @ @ &  l @ @*`* @2 2` & &  l @ @*`* @22`  &!  l`?& ,!& & &!<< ha@ ]P "< @ @  ( (? @2 2`  6 *   @  "@ `" j ? .& d "<  @ <C"#& d@(<C"& d@<C#,& d@<A"& d@<A"4& d@2 Y ܀ &    & &  ܀     a& &  ܀ "     b& &  ܀    `$& & 㿐 `  h!@  h? p#@+? * * 2` 2 @  '? <<bx@ R? X@ h <<bx!  t2 d*   ' h<<bx@ ?01 h $?@`X@ca,   @**` @ 2 @ `2`  4  ` io  ' < h<bx@ r? h< " @ `$2 *`@ 2 &  2`*  0 ( @ `2 *`@0 $  2`*  0 , @**` @ 2 @ 2`  0 @**` @ 2 @ 2`  8 @**` @ 2 @ 2`  4 @**` @ 2 @ 2`  @ @**` @ 2 @ 2`  @**` @ 2 @ 2` d @**` @ 2 @ 2`  ܔ @**` @ 2 @ 2`  @**` @ 2 @ 2` p (t (u *  *@ 2 2 @ @ h " 2!  @ @*`* @2 2` l "< @ @( *?2*   c *`*   (   @  "@ `  @  `g `( `h- `  @(` c7    2  !<b[" !? h;㿘 㿘 㿘@?$, ` ܓ22`  ` @2 T22`  ` @"T"2   &@"@T   !!`"`@ "` pV?#@    J?Ւ 2DE@$"7 ``  ܐ ` ܐ ? & `&   ܐ$`  ܐ ; & `&   ܐ!`   ܐ > & `&   ܐ"`  ܐ = & &  2㿘""<""<? " ""w?;  ?&<;   ? 2? ܔ 0 0@"T" !! `"}? &@" hT  !! `"l? h "  2d? ܀ ? &    ? &  ! >&  " =&  $ ;6& ; ::? &05 &@" hT  !! `2 h$? "< "<?;  & ?& < ?<# & 8! P'`h@ `, ؀  Ö,` &` 2- $ 4 `, `,, `,    @q  ?$*  2  n " as  "j  $ ;?#8,       @`? <" D .` "`f[``.`A'   * 2` - ʦ " fE `,*    7 ?$*   &  2`,- "  `, z .` `f`.` 㿐`D(`@$?0  ?@# ?*  *2` 2 e  h ?(h 㿘?'`3&T`$ /-`h`, '   "  $? ?'  $   2 " e 4   "Ұ `, 2 $?'Ȱ ?$c 2`*  4  `ܒ `*$`,$`ې< $<"Ȓ 2 ? 'e      @`?  ? 'eo ?# ? ** @ 2 2@@   -  * 2` 2 ?    ?2*2`  V?# @?*` @+` 2   *`23`@  "@  2`*   2 `   `*`@ @4  $, , @; <#`$`4`* $`܀ $`8M<3a  "a$`D @2 &d  ( "&dĐ& '   * 2` 㿘` `$@5 ?#<"ؒ  (?2 "$  @  `2* *`2 @   * 2 4   * 2` `@@ Ѡ?㿈?' <Cm "$ d`4 "א`@`D ' $ ?`4 $ƐHP ?# ?*  *@2@ 2@ " h!` *`<3a  "a& D@2  h c `( " hd!  h "       @` _" 쀢 "d6 㿈?' 4 &4 "$ d`@`D5 ' ?# ?*  *@2<3@ !2@ " #!& D "<   0<C"$ d ha 41   h!`*'  <A"$ d ha   <A"4$ d ha    <G h!` *`< 2 4 *   @Q2  hc6 `( " hcq  h "       @c` ^r 쀢 "'c'  $ ?`4 $<㿈V $`?ဢ %'?'  <C" h$ d` $ ,$ @   2  $ ?4 $`?# `$*`* ?'  + 2 2 # `<`   `@ *`@3`3` h!`? +`  <  @ * `+`3 2*` @   2'  h?  2`*  *22 *  h!`* 4 $` @ `bs `( `b`"hbېh`8 # 4 " "$4 " 2`@ `@`Dۖ ]' ?# ?*  *@2@ 2@ " h!` *`<3a  "a& D@A2  h b% `( " hb`  h "       @R` " $]a  $ ܐ  * 6 $& 쀢 ""'bf' 4 $ 㿐 ,   h   2 `$ < h<c@- ?# @?* +` @ @2 3`@ + 2 @   @?  * *` 2 2 <"@V 2  <"@O "  << hc@@T`  @ 2 `*  *`2@  ,@ C`" ``$`   `" `a `4   2`$%` <#  ?  **` 2 2 ` aɐ   * 2`  , À`` a 㿐`@`DӖ ?u'`?c ?*` * 2 2  b?8 ]?<3`" `Q& D  @"2  ha `( " haB  h "       @4` "T $\C T $<< hcp@8  $$ D`4 $$ , $<?6 $& 4& 8$ 8  *`& zI a0㿐`@`DM ?p'`?@# ?*  *@2@ 2 @ ]?T $   h<<c@  4 $ K<3a  "a$`D@2 `h `y `( "`h` `h "`  `    @` <[ <#`$`8`* $`܀ $`4 $ ?`4 $`8$ 8Ȱ  `㿈?' '(  (<C!c,`h$`d4`" ?  N  `;`@ `;N 2``;   2$`$`?`4`$9``h  ` N*`h ` ?N * @ _ڒ ( `"``B` $`,~`@`DO '`?# ?*  *@2@ 2@ " h!` *`<3a  "a& D@2  h _ `( " h_Ԑ  h "       @Ɣ` ZՐ 쀢 "_bE'㿈 !< "# 2V $? @$@?D ' ?# ?*  *@2@ 2@ " h!`-  "  $ ( 0     <3 *`<3a  "a&`D@2 `h _ `( "`h_> `h "`  `    @0` Z? 쀢 " $_S $< 6 $ & 8 `&  㿀`@`D']'`?'쀢  K'?c ?*` * 2 2  :`@ =D '䀦`2 "_' "<  29䀦`?' `?'  $좒 ?`$  2`*  ? **2`  2  `?ဦ` '쀦V$ @퀤`䀢 2 7<3D@쀢 '7<3< &&D  `$ 8 ?# ?*  *@2@ 2@ "h!` *`ሀ``& & D`$?6`$` &`8ΐ *@ & 8& ܀& 4`G?`$ @ ? @ +` @ +  2 ` *`23`@  ` @2  $] `( " $^' $ ?`6 $`" $`$`?`6`$ܐ * 6$&z  @՞2  h] `( " h]  h "       @` X   @2 h] `( "h]͐ h "      @` "'Xΐ '쀤`]耢 "]䀢 ]㿘 'P'T )'X!?` p6!: * 2`   * 2 2: l  @V  ]:  (  ]v . <c!@@ P @2  p?<c * 2`   0 !<W#%!<W !@Z < p?<c * 2`  P<F 0 `& 㿘 'P'T )'X!?` p6!: * 2`   * 2 2: l  @  \ɒ  (  ] . <c!@@P `2.  !<` #W8& 㿘#<ca@P'P'T'X@ !<W% X㿘 2 `!?c * 2` p 2: l  @2  `\{  ( " `\ `     t, @  \& t t6ē,` ,   \ ,  ,   \ ,  l \㿐 <2  " &`@ '*@ '<`@Ԑ < ?'`@ʐ '<􀢠"J < @` x<@` < '@` < 'ʐ `@ < '`@ 1<􀢠<J <<  @a < ? '@ya0 < ? '@na@ < ?ϐ @'!Hap@` <ax@Z < 'a@P < 'a@F < ?'a@< <a@6 < ?r'a@, <`<J@  <9!@I 6J@ X<;!b@ <`<J@  <"@- 6J@ <<"Hbp@ <`<J@  <"x捰 0.@ &@J@ <"怰 0!b@Ԑ <b@ΐ <b@Ȑ <b@ <  @6 ْ = 㿈`L?# ? ** 2` 2 <J#  `&  !  <#h<#`6  * 2` * 2`4  * 2` < "!<%`:`D?# ?* *@ 2 @2@ ?!<`@ @* @*` @ 2 2` # < P`:?c 2*  `6c @ * 2`  *2 6`:6`6`4? 2`*    2`*  6`4#  **` 2 2 &`, l`@2  Zn `( " Z  .  < D< h< T #d X`#\#`妔 q덐㿘 p?  *`*?  2  h2  @  ?\   -<7<5<3< d@ߐ 2 t- $ *  *` 2  2   T * *  *` 2  2   *H *  *` 2  2   \ a   h` @   㿐  -'4 77Xm c $&  2 6  ". cc. `!Xd @v* *` @WZ1 2  $6  0!.  #<j!?& p`8c  ;* 2` S & $  0!<!TȐ6 !. Ғ # L YܐH `L? * *` 2 2 .?`` @*` @ * 2 @  2` ?!<"Sѐ 2 p`d @ @ *`* @ 2 2` ?!<"XSz p? c ?*` * 2 2   *@. d>& h@29`LW5`   <)" " Yv 5`W ,` @Ȑ@Y 2 $< "& p`8c <#1 0j6 `L?# ?* *@ 2 @2@ ?`X * 2` &!`T @ @*`* @2 2`  &!<#0  0?6   &!&!`\?#? ** 2` 2 &!``$ **2`  2 &!`d @ @ *`+  3`2`  &! `( `& D@Q & H& $` ?#?  ** 2` 2 & T`$  ** 2` 2 & P`( @*  @ *`3  2`  !& X@& @!& L4`& \& d`& l 6!`P  * 2` 6! "`R 6!?# @ `*`2 @6!`:?c  2`* 2 8 6!  02` d&!8  2   $;#S@&! 26 !< !   26 !<#XR5`N6  D <F#6  T* <<#u6  P@ <4#m6  X@ (`<+ d6 ?`c ?  +`*`( ( 23    00" @? d & h@?,0  & t< P76  @) X55` t,`"@  t `2` ,%< t, @  W& t t1֐p6 @ܠ 5  |  , t, @  W& t t1˒<ⷐ 6    ܐ  " " " "  6 x6 z& `!. б #<C"& 6 P ? & , 6 @ , t,`@ `W@& t t1 <W< w 0㿘<#?c ? **` 2 2 &`0 l `@2 . W `( ". W?. 㿘 2&.  p? : * 2` ` @ ` 2 *`@3 :<#? **` 2 2 # , . 㿈! !77'쀢 S?& 6!6!@  @F p`5?:a?#! ;? 2`*  6:<c **` 2 2 &, l `@  V `(  VĐ . ` :?c 2`*  6!& d X 1  p?`# * *? @2! @ 2 @  h  Y 2 h   ` h `@` \@` p; #S''`?##? **  2` 2 "' p'` *+  @ 2@ 3 @ " '` +  *@ 2@ 3 @ %?' p@  **@ 3 @ 2@ &'̒ 'Ѐ '<;@ @a  ?㿐  @     q 2`$S ?p`V2㿐  h     @    K 2`$ - +  J    J 2  <;@  @  2?А`U㿘 h`$ 'H2`H`  PÐ   ` `P `HH@   A `@& 29 ?& h#` * + ?  @@23`  @ " 3 @ & @H U @< U  ( U\z 0! h "  H H `   @EHH` HPT H Uh㿘 h    ,2`  @? F ?,#`? @ @ *`* 2 2` 1 h S( "$   $   "$U5  @ "`& @m  U7 " $@@    ¤ 㿘?# @-?*` @* 2 2`    %?  h U  @ @*`* @2 2` ` Tߐ ' h<<` & @o TS (  T~  2z v   ,2`  2`@ ?, ] `$,` O? @ @ *`* 2 2` B h Rs "$`   &` ` "$T.  @ "`& @``T` @ S `(  T/ " $@ E &`$ 9[㿘?# +?* *@ 2 @2@  #?h  h TI  @ @*`* @2 2` R TN ' h<<a( 9& @: S ( 3 SŐ/  2+ 0'   ,2` @B?"@ & 6@ڒ$,  Ȗ @㿘 خ ؀  b ?# ?*  , @2@  h4 @ S  ؀ J SF  h<< a8ǘ & Ԑ5  4 @ , @"@@% & @6@t $,`@m@*`@v 㿐 "<  @ @(@ #ު䢐 Т >'< "  2   <] <]<]4 "%Ho`<!Pj2e 4"4*` "   €"` 2  1!   h 2``  .2 h h`  ,?& `:    h  $"@@  @w R[ (  R RÐ & 4 & 82 0㿘<CZI#`?  <" <㿘  < ?< x!P0  & < @ < m!p@6㿘 ? /<D#Ѐ€   "6 $㿘 ? /    € 㿐6@ F6< @w a "@ !< =@v '*@ '@v~! <`"+ J@  @w 6@@vja 2 `" J@   @w 6J@   @v͒a 2ǒ = 㿘` " h ` <  (`@?‎`" "29? &@<  ( 2<   "( T  !! ``  < "  ?T  !! ` ?㿘  2V??/P6  M h Ho`<7$@h``;  <* c ``` 2``fh 2 H/`$@h` `  ?    ? 㿘 @ <!.< l?  /<D#Ѐ€  h<!؀&  "6 " 6 &6 ( 2& , 2& dV  6 $ƀ   :H/`<7c$@dh` <H4  ` "4 $ 6 $4 2`H/`c$@Ih` 0:㿘   Z . <C`!#$'㠘 & & <D. & $Hd  "<C & , &S ( 0!. ɞ #0<ۈ!m6  0!. ɐ # X'#$ ?'''''̀ '<;@ @  ?<#?$"4"<"8"0q"@ 22$"d2"2&2( g",H`<7#$@h`;  <(`:?`` 2``3? "b`\ b2&b2( "?fl* *`<H @("d",2"`@2"`"2"H`#$@ih`㿘9<E <d  <d  @ D" <D <D' &<D@ <DԐ`"""  ?<DԀ  22?  <E<d<d@!D<D"  Н㿘<}"0<E`< #쀢?㿘<i"0<E` < <?€㿘<CȰ  `2?("  0` 3ȃ(`  @(@#?㿘@ 2  ( 66@(? (<&` &`$& (`  (` 2 <D"&`  6 `   <E!  <H d&` <A0`<G`"@P 2 @"@""` @`2`㿘 (( (<C#2  <# "  ?6 p/ 2 (`  @ (@  2?x<`bP@vK&  <;@ @˔x`<bP@v2ix㿘   "? 1 2 8?􀢠€4  <;@ @0̒ 㿘   0  2 8 €i80    "@" " 㿘 ?   ( ` "  "  `D2  `@@  "   `<G? @  h? &`Pn 㿘  ;<D#R6 $H/`<7c$@vh` <H4   ` "4 $ 6 $4 2`H/`c$@[h`  b `@`D<7? J?Ѐ`  +  *    H/`c$@&h` ; @ `<*`#@``` 2`H/`c$@h`   `+  h<G`? 2  ?"$ <G &`PȐ 㿘  ```G?   "`$ `(<c`  ƀ 4  `B > `$<ch ƀ %  `B > `(? ?` "@` ?` `ƀ  &   `B > ` `2@  ? H`<7#$@h`<H 4 `"4<4+   "@H`#$@jh` 8   p 4 1!> !  :& , ,   @zА 0-@{    "ƀ &   `B  >  ?0H`<7#$@ h``: <( ` 2 \ 22(2(2&H`#$@h`㿘     @`? 㿐   ` '.Β o?jf ,`' $ `` `?@  '0L,  $ ;'4 "6 "0/<;@  @*@ "? <  :@ C>@ .' 㿘  ` 4  ,?    ?&?;  @B B; ??㿘<D#H"  4 " ` ?@o / 2 (&&@ 㿐'L 'Lؔ 0@~E#  '@~B D D@|<@ & @ 6 o"am<D"\ &  6 `o @o"a$ 6 6 L㿘0/$㿐`'H'H $@~pH (   " H) < & @6 ѐ0H<# 㿘7 *?`&` 2`0 "`  "   `@ 24`@:` <(  ` 2 "  2 x2 㿘  H/`!<7#$@h` `H/`@h` 2d?py 0[ m@ ÐR f @ K 8);6 @  <@ "7 @  2<@ @  ) @  o " 4 " &<  @U&@   2  p@ w@ t  >$  2 ? @B 6; ??㿘  3` 2`ް?< @<! Ӱ?`fp" `,@ N   8 ? $fp@ '@ $ 2?@  ͐@ @8@"?@  Ò@ @"? : ` !? " `$``," @   fp  @@  @ `:e`fp   8  @Ԓ@Ғ@Вp@̒@ʒ U?@Œ P?@@ 2 `  C?` "@@ @2 @  2?@1<@@@@@@<<"cđ2 :`@@"2 * @<<cЃ(`@` @`$ $` @@x` @t 㿘 }Kc1  ? :# ?Ho`<7$@{h``;  <* c `Q`` 2``J"fh & "fh 9- 4( fp .`*` "` `0 2 ` `2`0?fl*` `*`@       &H/`$@h` 㿘 + 2;?   "< 0@ <!H@ <!X  @o 0$@&|  <;@ @u* 㿘 * < `? 㿘 ?2`#`y @`2w?`D `@J 0"n??J?Ѐ` d+  *  ] H/`<7$@h`  ;` <* c ``` 2`` fl` `+ `@H/`$@Zh` "?  +`  h   <G &`P~V ?㿈?`#3   `)?'<`  `hƀ `B `>Ho`<7$@h``= <* c  `2hl] `@,``@"M H -` @w 0-@vȒ  H/`#$@h`  @  "@ ƀ 9Ho`#$@h``@```B >l``@ `H/`#$@~h`  *++,`+8+(,`,`,`,`,`,`,`,`+H+p+++++X++,`,,`,,(+,`,8,H,`+.0......D.X.l...T !  ?!@yH<<cĔ!* 'H 'R "8 !!"H` <;@  @@&"@8`" <;@ :@yU@&"<;@ : <@p@ > B>㿐<3<3!` *`* '5 "@ 8  <3a;<@ : .@` 2<a  ?<;@  @@ > B>㿐 2<3<;@ @)    ? <3?!<3@xғ*`㿀<9#L`%<9#L `  Ȇ '* *`!<9 #ě(@(*#<9 +`cК@0 ; <#\#`#d#h#lb : 2 ; @mV3` @<3<3 !  9<5#<!<5   c4,#**`" *     !<a@u"H!!   @  " @m *<!  #4  7<@@@(@+@, @*`@* *@   a"@ @`#\@l` !!<!bx#\! #`!#<3#d!#h!#l!#p!#t!#x!#|!#!#!#!#!#!!!!#!#!#!#!#!@#@l#<c`  @@ <<5 #4c,**`" *  @  @l!)@a@tz d<c"<9#<c@l㿘<3!<3#<Тc0a d@ta@uC d d@tY d@u;@lj@1R!<=< #\ؑ* #`̄#Ș Ж" cH;h#d@lM +`#\ؑ2 ȅ0 #d<Ԑ@#`c2 2 3 @l73` 㿘<.#d@h@w㿘<<`H@l%㿘 "K &p`"G <@:C `   `<v P9 @ʒ@ 1 @  <c x@$ @@ @  <M @ @@ " @o㿘 @  J` /`.  `@/2J㿘Ho`<7$@~h``>  <* c ```2`H/`$@~oh` `  fp   P L㿘Ho`<7$@~Fh``>  <* c ```2`H/`$@~/h` `  fp   Hb D " " <<`"` &@ @   `<  `8 "`"@""&   ?@ 3 * @ * "@3 *  )" `hHo`<7$@}h``>  <* c ```2`H/`$@}h` `<а `@tX `b ff \ n  ` . \ .  2 ..  2  .@<H `#2```x< `a b`` a#\b#`b#db#hb#lb #pb @jm#tb %<b, h@jbb  @<@jYapfp@9<. 4 T X \ %0" 2 !@    2  2##`<. #@#dax*+ #\@j@<@ja@ī <*a@j ğ*<b@iĐ<*b@ią* bT<bXb\@ib(@&@Ho`<7$@|h``>  <* c  `2 H/`$@|h` ְ <H&p#`""h2``   . <. ) " " @@ 2 T \ 6T\"\ ""T  !! `" H H/`$@|Hh` &D"Ѐ?   2`@  :`" " 2`*  `   x-  `:` d<#\"X l#d#`#h #l!#p!#t!#x!#| # # # #### # ##&p "# T#"#"#&p "# (#&p "# ,#&p "# @###& #&  @ ####!#!# P# (#@h֘㿈'L'P'T@'X8'L9@"@  'u'@{  <#@sj@n@ 85+%Q @\  <"@TF@N,@ $p3\`@=" *P@ "@X "@/1<<<"cđ2 @@%"2 * @<<Г*`@`@ :  T@ "@@*  @ L@ }x       Ho`<7$@{h``>  <* c  `2 H/`$@zh`  2&pC `53<<. @"1#\@ "-#\ @&p  #\'''' @     !2@  @(@   2 #\#`#dc@@gÚ㿈'L " ??Ho`<7$@zh``>  <* c ```2`H/`$@zvh` `fp <. @     @ :  * *2 @: o     <  8 q4;<  -   r/  - w/  - x / p s// 0    wP ?ϐ @-9 cX  ,#\#`@g 0` 1p ,@  1&,@% ,@ & D8 " <;  @@x& D4`2 4, @ , = B?L%! 㿘H/`<7$@yh` `` >  <* c ` ``2` H/`$@yh` `2`$ <`Ԓcx@f<3`   <ad#4+< `@*`+`@  @fyc   㿘`!b<"d*` €YؐUQfM!IۍET?;77p3@-Qɐ)G%!楐@/F( , q?  H`<7#$@xh`:` <("` 2``\\0b\b fp" H`#$@xh`` 4  2T2 T !   㿘` %<"*` € A?㿐  ,  k 2 ~?? 4 # ` 'W  ! l? ` @ `Ϙ  0J " <;@  @v > B>1>  ْ $ @B  @ &  <;@  @v< > 㿘 ? c2   ? 㿘  i 㿘  b  㿘[ 㿘<: `"<:g#<: ` A 㿘<`H@d  $@&&@㿐      ?09R 06';/,4,<I!̀   Ŗ @<  @u > B>&Ҥ 㿘  )?<Ià   @ ?"  <;@ @uÔ a̒   ?     ?;   @B; ??`<b# t /<-<1<T ` T  @cT @cT  "    *5T  #*/T T   <-  <( <<# ! < T  <<  T   < <<  !:@c! <! @<!@  T #\@c@@@ @   2T  @ '& @&&@㿘<ܨ#̬      `<!H@<!X @ch@ @6`  ``@` '& @&&@㿘 2   ` H <d!L '  "0 ","4& H㿘 H <daL& H㿈` 2 PN@` ` D < !2 P<!  P''` @㿘 h     ,   2 $@֔ " $ @ @* ;X 85 i @ @  % @lk? @ ;A`  @ "X $@lV h ! Z` @ G 2 h `[ @  `Y a n@  `@{`  h X$  `` ^ y U`?:  , z : 㿘 h ,`P  L&`P ?$Q  `  hw[ ?qq8 㿘 h @i& h@ `   H H."??  0 ("` ` @  H H." <|`   @   0( "` 㿘` @ ?`."   ?`."   @ @^  2 㿘` @ ?`."   ?`."   @ @p 2 㿘` 㿘x 㿘Ŗ 㿘 㿘B 㿘Z 㿘 㿘v 㿐 n y u$!m.`.`.`&`6` .@.`.`6`6`&` .`< @^oa <!<J!L   L L`@ ` L L`@ `` @p:  < n.`J!Ȗ!L   L J@ ` L J@ ` @p  < n`.`J!ؖ!L   L J@ ` L J@ ` @o  < y>.`J!!L   L J@ ` L J@ ` L J@ ` JL " < y.`+ J:`@耢` L J@ ` L J@ ` JL "  .`@]J = <. a@]4 < b&`N  ,2 `"ް .b@] 1< /b(N`"<N  2 <<@]" <.@b@] < o.@b@\ < n.@@\b   a.@b(@\ (< &bHN`"<N  2 <<@\"0 <.`b8@\ϐ < r}.`@\ƒb@ ~  st.`bH@\ - "s N`" <N  2 <<@\"P _ <bX@\ W<b`@\ Q<bh@\ K<@\bp F J "H <bx@\ <b@\ <b@\} <b@\w 2/  @]'J`2$ L g"6` m b 0 u  0 &`6`6`  @\ƒ [< . 2 1 G   C  㿘 h   X& ,&    4 2  $ 5I `< $ ` " h5 h  x4  8  %%`!   : @f% 4    5 *@ $@f@`  ,@& ,& $@J  `d" `   4А ?4ʐ?<!P` ?  ?< !߀`㿘 h  X 2  4ɒ <  $  @@   $<r!  $@@e4 `4 ߔ$ $@e ` @    !m 6 "6 $%`  h `b  6 $6 " `  @ ` L`!`!@ 6 ` J . ;2` ` @`!J `;2 h " I6 " hf6 &d& <6 (@q& @& L     ,@c& , ,@  h ]`n `y< "  h y*`] h ]`y2 L` ,?@*@& ,L` <"`& ,L` < "@;`& 4& 8& 0@1`@`& @ h`f 26 & h d 26 (@` h ]`n2 " < " h y*`] "<  @ & d<I#<$& d@(<I#& d@<J (& d@<A"& d@<A"4& d@a-   30<#  6 $6 "& d& 8& 0& 4& & ,& <& @6 (6 &  1 ! ! -???( .  ;H;;H1; ; ;H1 ;" .*@   ڄ? 㿘ƒ 2 L  !2 " " C<L c@Jc@  NK @ ` NK @ ` @iɔ  $N@ _2   !.@     ,.@ @  *<  @ZcP 㿈 h   'L /` 'P`@cܔ X' Ķ 2  $V  $@ *  @ "`2Ր` xh ?C   @c>`   %@c `2   @ $@cΔ  J@    `  B>`o    L !  `<`cX  SL `  L ! 2 h`< c` L@` h `^ n  2=` Z   @ ` `! h `[ @ `Y a n 2  ! `LP@  `  B>` ,: `49  `3 2 㿘      $G 0? J 2?  ( (㿘  ( @ (@* @ ( (*`  㿘hN`N N N N N  N .F (   (''''??'''耦'섆,8`  Ȱ@?`2`4((( (( (? 4h/  ((&㿘N !       `? `h `Z   !`2 "M"q *   L @/$@  "RE@/L@ `03@#P@`0,L  N $` G`0  C  >`0`0`H 2D A > `4   I#   `h 1`  $@@b0  ߮ <ʐ#h0  %㿘h Z `    .@  !`2 "c" *  "E @N$@  "R#E@"M@"`0I@#P@`0B  f`0=  b  ]`04ɐ Ɛ Ð *(`  ` #` ``<f#`@c  ?   @T   4? 0?`4    ݒ  h 0z  $@@au0O  ߬ <&#h   㿘`h Z `  T   !`2 ""C *  ` X @ ^%@#L#L@ 4#E@/`0!R@"4`h N@U`0@ ? #P"E@ΐ"R@ `0퀢@  F@Q`0L` `0 `  ` `0 ` ` `ͮ <*Z# `  )<'<`L `  &L#``6`"` 6`$`6`&`6`(ݐ`ڐ`  , 6`*,  6`* `  `̒ &`8  `  , " @ &`4  `  , " @ &`0  ` t, " @ m&`8&`,`$h`, ?    <0 <0 `, &`,`,`,  &`,`,  &`,0# "  ` ` ":`, 26`,`,  &`,ǀ À`, &`,%`,<  HU``h&` Pk*@ ="6`"$6`$&6`&(6`(*6`*,&`,0&`08&`84k&`4`4 E#}  `h /`  $@@`.  ߸ <Ɛ#h0! 㿘h Z    ` <q H .2@ ܒ?$  <  !`2 ""@  *  "R %@ #L#Et`0|#P`0u  `0p  `  `0g`c-< 2 ,   `. ?     <  < @R  <`<`@Rg  @Ra 1 "  ``  #` @RK`  ` `@R?`  `YV S`4o ` ^   h .2  $@@_-.  ޺ <ސ#h-0` 4 " / <ɐ 쀦Ő 耦㿘4#   @a4 <;@ @fϔ  2?㿘 ܰ Hv0a?㿐 ` @`@`  $,㿘*@   @[?2&. `@` 4`&㿘h `\  `h  !2  !2    ;   1"?   ?`."? h   :"<2"2*"d:ȄP"T"PX"\"X`"d"`h"l"h"p"t"x"|<3lᘄ ""<2h pha"@"D㿘<\#䀊`< !(   "6 $㿘<\#䀊`< !@ f㿘 D@#^ D @@# "@C@ 8㿘 D @6  D ` @<!`      D@_t L`2@<!6 `<`!<!<!y @`$&a\@ $&a`@  D`( ?&`( D@_M@`4 `( '`@] `L  ad@'<Q!o6 @]af`L@] `2 <A"0_6   5 .   ! <J@ !i& $& & . a`   D`\ 0  D`\  0 + " * *& @^ D`,#8  @ `   * " * $ `0#8  @ `   * " * $ `(?c $ `(` "`<&`@&`<&`H&`D`<*@ *`@ *`$ $`@*@ *`@ *`$ (`D*@ *`@ *`$ ,`H*@ *`@ *`$ 0a\@^$ 4 A  $ 8@O`( <K"$  @&  <J"$  &  `4*` `(* `:@'7:"`#p' ` /`#p n'W ` 7  @Ҕ 2`(<^"h_   !2 <J 8@ 2`(<H"I 2  * * @$ `( *@ * $ `(2 * * @@ $ @#$ <'"( @t `(  ?&`( @Q'@v`(` a & ,<J"<"`P `T  6 4<"` $ 4@! 6`,<#0ဢ 2!`0`"`0$#8  @ `   * " * $ `0 !H`L0#8  @ `   * " * $ HL@2  4( *  ?H  H 2  L ?H  H 2a`L ?Ha` 2 L@` `   * @"  * -&   8$  /2 $   $ $  , 8$  /2 $   $ $ 8#8  @ `   * " * @$ $   8$  4  ( $ 4!. ! # ",@@@ `f@>@"@!.  #@  8 "<G<#86   D ,  T`А < ΐ#`@\ h!i 'P  ?  4'O`   * @"  , +O'T,? @@dB'XB@d'\B@dݔ'`'d'h 't<;@ @bP  ?㿘 "<   h p h!<3!&!D&!@!!H@\J ! "<   h`t`l"?&!㿘 "iE6 "א㿘 " hX<> P > & 6 "<J!D'& d(<J!& d<J"X& d2<A"Ȁ<A"4& dJ 6 *2& dV88 8  `&& ,#& ,h<& 4` & 0p& 8p>! h>!(` ">!08  >!8 h p h h<3!&!@&!D @Z% D@ 㿘 P@ T@2  X@2 \ ̀   @_l D`?㿘 "<$ 2 h   @_S D  h@w D?  㿘<\#䀊`  T <@#X @@㿐 '' X  < @e )<\#䀊` < # h 0<d#Ё @   <#X05 "<  @ ?&@   @b  4   h H`    0 !8 ?!(?! 7?@fx @ː " !0 0    ' 0'ذ㿈 h!`D  `&  2  V @3 !J'H`<9#D@bph` l  h'& l$cD !! 2>!H`cD@bGh` `2"`$cD@0M'H`<9#D@b#h` l  h'& l$cD !!  !!!H`cD@ah` `2"`$cDd>㿘 <3!!@ h D @ 㿘 h  D @&`X㿘 h D``X`@ <\#䀊`<`  ("`Ȁ`_?g Z?a V !<3   Naa@! a D B? a `h6a`H c䀊 <`  H`? a`c6aa@   c䀊 <`  `Ә a <`  `a?# @6a`lԒ #㿈 ?`2 "<  2@<!  "f 2<\#䀊`< !H  @ `P Ā@`T ̀2 `X `X@2`X`\" "`X  Ț`P`\<#` #\#d!xq˰<`$  @2*`8`h  `<  `<3#<3a ;!8&!@   !< "!( !(!,"@ @ "!h!8`@2!h!<` @2 !h`2!h!,`@" !h!h@"`p ,&`p>! `p & 8``>!0`` 0,& 0& 4>!8& ,>!(`&6 "`*6 $`.6 &`26 (@ "`D`@ 8  `&!#!:  h& @ & @`@& < "< @ 6 *@`J6 *(!D!@a ! "< * &!@ h t 0 h l   "<  2lt&!@a&!D": < !2U㿘<J@{ <J-V 㿘 <\#䀊` <"8 @K㿘 <\#䀊`  <@"P@{<3!!@ h D C u㿘 <\#䀊` <@"pX@<3!!@ h D   ֒㿘<\#䀊``<` "8`  @ M  4  P& P㿘@|㿘   2 h `T@Œ  㿘 <\#䀊`  <@"@ <3!!@ h D ɒ  ܖ㿐  <\#䀊`@  ` <`"%$(,#\`2`"[? $$"W?`h Lb`"0 / J?$  E`L @_c?   @ Ș  4  @_:5 @3| 4  % `L @_8$    @   @_ؐ@ŐNj@Ȑ؋@@㿘 T<<#Ь & *` *  *  *  `h P:  * <@%'|<\#䀊`<#h1 2 X @_|'<4#䀊  `h|`` #\#``h H#\#`` E |?"?  $@Ѱ@V֒ @^  @^!P!P  ` 0 2 4 "4 㿘  S  ``  @  2` @b =@ =`h.`8`<3`4` $`4$`8<3!```` $`(@!P!p $!p`(@`8  ?<#@ $`8`$ #@  @  ?  `hap T@  `, /2` : @` @ `@c㿘`( '<?@ʐ@ap<<# "@ *` *  *  *  :  ,*  $@ 0$``` 0 &`@ݤ ap`&`&` &` ,   >`&`&`&`&`㿘''<` @  @]̞ @] # `8` @0$`8 #@@2x`h  D!x ";@Uǒ!xp$t$p3<'@W <% $P$T ?''<\#䀊` <`#` #\@ @@I@# ?㿈'''' h`T  @ @ 6@ 6p㿘!P@ؐ!p"!P `?@ `?&!p<o#㿘!P @!p"!P `?@ `?&!p<V#㿈''''ޒ  `㿈''''  `㿘 T<\#䀊`<  ( Wpp@@)<p? @  ` @\Ğ` @\ @\Ԟ` #c䀊   X   `  , 0  8  ?<ߐ#@0$ 8 $ #@ސ@ܐpǠ?㿘#<\` `㍐` @\2` c䀊 <`  x` 2   @ Ø  4 `  ? h Po̔ @ @\h` #㿘 T`h  X   X<\#䀊` < `  `Ț@k<<#<& *` *  *  *  : *   p*`h`H #\#`    a8a(?a ??7u` @ @\ <!(#`,'&`, ŀ "㿘    `,   ? 8  hL% ` `, `0p  l2 $" %2  ( 8 ,@(  2  !h!h   ` 0 2 4 "4 㿘  <!0' 8 2`<"`   2` 2 @*"   2` 2 :" & #`"& 㿘   8 2 <{"@  " "@& & & 㿘`h  %<J'<\-<+<`䀊 <`"x `h@Ɛ D@0  H   @S2 H&&  & &  % 䀊 #<\<``h L`  dː `c  = dc䀊 b%`  ! &  @Z& ,& 0 &   X % & `h  D@g&  & 4& `$ $㿘 h 4`? d& 4  @<#c6<#H@1 8 2 <ِ!  " "@&& !|!h !h`?@ `?$!|<Ð!!h!P\!h!P!P@@ 8 <#x  "h  D`@U  h<J?$" #㿈  h 8 `D  4`& 4 2  V @  8 J'H`<9#D@Yh` $  '& $$cD ! 8  2>!H`cD@Yh` `2"`$cD@0M'H`<9#D@Yh` $  '& $$cD ! 8   O! 8 !H`cD@Y{h` `2"`$cD㿘 ??!h!h" `   2` @ 󀢀@ 8  4`'$ 4 @㿘 @"<3 (!@ @,&@ 8`  4` $ 4$ 8  瀤@̒߰ 㿘!XӐ!t"!X `?@ `?&!t<j#㿘!`!x"!` `?@ `?&!x<S#؁㿘  ??@&@ @  2` @ @@@ 8`  4` $ 4$ 8  〤@k۰ 㿘!Xǐ!t"!X `?@ `?&!t<#㿘!`!x"!` `?@ `?&!x<#؁㿘@, ?   2 2`  @! , O , 0  @ ? @" 㿘ah ah  2    2` @ 2  "" 8`   4  "4 4` & 4& 8   ah"` ,\ , "8a| 8`2 4` & 4& 82  8 2ah<j!Xah2a|` &`a|ah &a|"`&& &ah 4 & 4  @ aXat &at (@`# ,   @[ ʘ Q> <3!cp y$ (<3a!t$ ( 0 @ 2 8  @   X `?     8  ?< 0& 8 $ #?#& 0& , ( 8 ,$& 0 8  ?< 0 ?& 8 $ #㿘 h H@!t  \,     @ !|    @w !x, @ <J!`   @ !|    @ǘ 㿘   א  2`   ` 2   @  4  4 㿘 <\#䀊`  <@ ` @q`h Xo S<8?` 2   @n  4  ) 0@  ` @W ` 2  @R  &P 6 $P $P , @ I)䀊 <`, @ ` @V㿘`( '<?Mat<<# "@ *` *  *  *  :  ,*  $@ 0$``` 0 &`@ݤ at``ah&``&`` &`` `,  &`&`&`&`&`x`h D!f  @N!t$x$tG@ `" $ax   $$<.@,<( $P$T`hH`  ''''<\#䀊` <` x` #\@{ @|n@@{+ "'?#< aXat &at (@x 8` \` $ 8h #Z2?㿈'''' h`\  @Qg 6@*@%1<@@i!X!t $!t(@08`   @&8`  #@2@㿐 T   <\#䀊`<   `@: %<J#<3a@< ?< a!0@$?& `  : %<J#<3a@<䀊 < h|!Ĕ a!0@$ @@   !8; !(; !  ; 3 !t!t@Ӯ+<!t䀊 ` `,aX `  Ȇ  `0#\ 6N  @Ue @UF"2``8 2`<w!``" "@$$`!|!h !h`?@ `?$!|<a!!h!PWB!h!P!P@@IU`` "`P䀊 _< B!x[`8@ =42`8 2`<1!``" "@$$`!|!h !h`?@ `?$!|<!!h!PV!h!P!P@@䀊 <!`8@KC <3!a$`(`=!`!x $!x`(@䀊 <!`8 2 ?<  !t$`8`$ #ߐ!t23!t㿘 ? ??A at   , 0  82&` `&`&`&``,$` `ah&`&`&`&`㿀!8 ```@Ly!at$ax$at`2@ at<0 d`h D@<( $`P$`T` `?'`'<\#䀊`<`l!@y @zS@@y֒+ "'?%<ΐ@ a`ax &ax (@] 8` A $ 8`M #?2?㿘 T<\#䀊`< !%  @@   !8; !(; !  ; 3 Stt@+<t#䀊  a` ``   `,`0  `B8` 2" P2#`8 2`<!``" "@$$`!|!h !h`?@ `?$!|<ѐ!!h!PU!h!P!P@@Ő#䀊 Z< !xV`8l@O^  =#2#`8 2`<!``" "@$$`!|!h !h`?@ `?$!|<!!h!PUp!h!P!P@@w#䀊 <w!`8 <p"`!X!t $!t`(@y`8 2 ?<\  t$`8`$h #Zt2Ht㿈''''&  `㿈''''  ٔ`㿈''''  o`㿈''''      R`㿘  ?` `       瀤 ?㿐<<#В&@ *` *   *  *  a: * 2< X@<\#䀊`  <`"0`   `h ` H#\L  = a?# @4a  `@R<` , @RL`| # ` @R& @R=`m #& $?㿘<<#<  "@ *` *  *  *  : *    <\#䀊`$ <#x 5 @> =  < ?2  & "0& $& `f @ ``ƀ` 6` ג & c䀊 < #  㾈  'H'L  (3@I֐ @IӐ '<$`h H`X$ 2/<\;<<9<䀊  <# Ӕ 7<15< 䀊 `<"ƒ  $8Jcа $ * *  *  *  a : 2* $  -<$ 䀊 p`  `@`@  Ӱ  <($䀊 <"u $: 䀊 <"g? "0$`$ ` 䀊 <#HR=u  2 @"w   X䀊 `<# 6  "  $ ’ "<?2 * @cГ*` $ * *  *  `h*  H `: #\* `L  <(:`H$L$$ $$ @HӒ 䀊 < 0 䀤`6   HL &  ` "$ $     ?? <3 @ ; # ( # T  2 `      <#`4"@ a+a@d8 d L<3a ,g 0 U  <\#䀊`[< @ Xv @U 0 ` !@ <`4" #$ <3 L!@ @ <`  2! h, D01 24 0`h H8` @ &8 # @2  0 @2 0 @2 0 @2 0on 2 0& L#  0 0@KKJ 2    "`"& & 뗐  < "   댐 ``` ""`"`㿘  @ CQА<\#䀊`` <@ `@ h x`D@ %?<J"<&`P h`H8 `@?  $  ?LKS<3! &`L㿘  ?KB<3! & L㾸<\#䀊`<   `@ 'ؐ7 h`H`(`@ؖ    ̐ ` ` `"`"&`&`㾸<\#䀊`<   _`@ 'ؐ7 h H``P.2`@ؘ    ` ` `"`"&`&`㾸<\#䀊`<   )`@ 7ܐ' h`H`D`@ؖ@   ` ` ` `"`"&`&`㿘<\#䀊`<   `@{ h`HH€`@ K㿈''  2` *`@@  'J J 2  ?ܒ G㿈`?<\#䀊` ` <@!`@@@ Y` 2 `` <@!(`@` K?`< a` @;'  /<` %<J'< TGT` $Tp @; c䀊`x`@t`  <!  ․ '@Fh'`H8`@  <3!&`LJ’@ oG㿘       `""& &    ;<\#䀊`< @!. @ ? <@!% @ < @! @!颐 <3 "<!  h`t`l"?$!`h`H,€ @ J0JQ㿘<\#䀊`< " `@`     (  ?  <3!&`L㾨<\#䀊`< "8 `@ h? H@ /$@F B` " ?` <@"X`@?! 7'@E'' - h8`H@`@ 8   ܔ `` <@"`@` `"`"&`&`㿘<\#䀊`   < "@ @ @g@ "`"&&<3 "< @@ h`t`l"?$!`h H@`<㿘`   `""&&<\#䀊` <`  "@ @`@@) ?   ;   "@ Hd@ >[ 2  H < @#@      H&  < @#0@Imk h`H8`@@I- ` "<  I7`E㿘+ h`H MT  !! `2 hT  !! `2  h "  h ?+ h`H ?  hD` 2     2H  H` 㿘<<cА&@* @*`@ *`@*` h@ H:`*` <  /`  @L @L%`U # 㿘 <8 ٛ<&<<#<$ *` *  *  *  : *   <;@  @J?ߒ 0㿘 <8 i<<<#<$ *@ *`@ *`@ *`@ :`*`  +Ӑ  㿈!<\#䀊 <#6 ''''@qt #䀊 <ѐ#㿈!<\#䀊 <ǐ#6@ h `D ''''@qW #䀊 <#Ё㿀 ''5<\䀊 <#6@ h`D ""''@q7 䀊 < h@ `''''?3<\c䀊 <  6 h`D """'Ԓ@q c䀊 < 0lp '''''3<\c䀊 <\ H h`D """'ܒ@p c䀊 < `H В ?\ '  @''@C  '''''?''?p'x'|!<\#䀊 < x!6 h`D@p#䀊 < `" А \'`'   @'''@BӐ ''|'''''?'?p'x!<\#䀊  < 6 B h`D@pz#䀊 < ֒ $h` @'''''''7@'5<\䀊 <@  h`D """'Ԓ@pK 䀊 <!h@`''''''?<\#䀊`<! <  /@ ?6&2 7@. 2`&& 7@h`D &&&'Ԓ@p ?c< c67@hD&&&'@o c䀊 <!0Kh` @'' '??''''3<\c䀊 <!H2  hD@oɔ c䀊 <!`%㿘 缒   ?@A` `$ $ $ $`$@㿘` <3  "<! @ @ h`t`l"?&!U`h@` ''''''''''''3<\c䀊 <!x ֔  h`D ""''Ԓ@of c䀊 <!’x` ''''''''3<\c䀊 <!  h`D ""''@o< c䀊 <!h@ `''''''''''''3<\c䀊 <! { 7@ h`D ""''Ԓ@o  c䀊 <"fh@ `''''''''3<\c䀊 <"P 7 h`D """'Ԓ@nߔ c䀊 <"0;x@ `''''''3<\c䀊 <"H'  h`D ""''@n c䀊 <"``  '''''?'''''?3<\c䀊 <"x hD@n c䀊 <"㿈!<\#䀊 <"@@Œ h ''''@nr #䀊 <"Β "@ p 㿘@?  ` &@ & p&  㿘` @>` ` ?&@ `?" `?" `? " ?"@`"@"@`"@! `"@`"@?"@`"@` "@$ p$  㿘`@> ` @t  " $ p$ 㿘`̔  `@>` ` " ""`&@$`p$` ` <B"? , , `|$`x@>|.` `Ē@$`$`ȁ㿘@t `@tw `D@ ` ` `$` `(` `,` `0` 8`8` `@` `H` `D`$ 8`P`(  8`X`,  @  C8```4   @8`h`< @ @  D8`p 0@? <)   ` `$ `H@`&@@<#Ғ#? !<\#䀊 <Ȑ#H@"#䀊 <#x  Ē@" &&&㿘`@= ` "@`"`"`"` `&@$`p$` ` <# ?.``$@=͔    <" @c" "  ``p `l@$`l$`p㿘`@= ` @x ` ?&@ `?" `?" `? " ?"@`"@"@`"@! `"@`"@?"@`"@` "@$ p$  㿘`@=e ` @+  `@=[  @"`" $`p$` 㿘`@=J ` ` @=D`  @   " $ p$ 㿘`@=2 ` @ @` ?&@ `?" `?" `? " ?"@`"@"@`"@! `"@`"@?"@`"@` "@$ p$  㿘  `$`  6 `@<۔ ` "`"@ `&@$ p$ `,*$ x$ | $   Ĕ  $ $ ȁ 㿘@ t `@H  t&@ @<7# <\#䀊` <b   @"  @@<T P'?@ "`` `@` ?@`  ` <@  `0 < x3?0</ &&   !?# = ; # ; #  ;  @ #   㿘@ @C 㿘@ `@9G @& `&$`&(` &,`&0` >8`&@`&H` &D`$ >P`(  >X`,  @  C>``4   @>h`<  @  D>p 6?  <(@  & &$&H 㿘@ `@S  D@={ $ @;Ӕ ` @& `&$`&(` &,`&0` >8`&@`&H` &D`$ >P`(  >X`,  @  C>``4   @>h`<  @  D>p 6?  <(@  & &$&H 㿘 ̰  `@;  ` &@ $ p$ `,*$ x$ |$  Ĕ  $ $ ȁ㿘@ t `@l&  t&@ @< ? <\#䀊` <!  @="?@8"*  㿘 "@㿘@ 0`@ c&> & &`&&&&@   `>(@@E+ >0`@(@E$ >8`(@E   >@>X&d>H>P@ 㿘<J#  ?   2   ? <!@c , `@㿘<\#䀊`<" @ 2  @O  <3?!# T$ $ <A $ <@b# L# H@   㿘 @ "<\#䀊`< "`  `?Ő d"` @{b  d  `2   2 㿘 @ 2  ܒ  ?@< & @ 㿘 @ & @㿘<K!p@~r? h!@"!``@"@! @" 2!㿘 h!`@   !!`@2  ?!"!c 6!EՐ㿘 h!@`&!<3!!`d@, `2  hB D0@@zސ 㿘 <3#p `?<\c  < " T @$`;?#!a 4!$!  S    !h!!@<!h!@Y$! ^ !h!h@!P!P@b!,Ec`ˠ䀊 < r#!  d!$!<@"& H& & p@  $ <K$ & H<K!p @z 㿘 T @ @""  W #㿘 ? & <Kx x2@ "x@ 2@"@ ა㿈 T?   @:  '`h `H0 @h 0& & H㿘 T``ށ h ( H4€ `@$<㿘 T㿘    h?xD -@: <K $ax<A$`$@$`"ax `$`, @E<A<A!b$ P$ H$ T   & @ $`<K!| @yp 㿘<K!x ,  2 %  $  D4 ? "  @@8Ԕ `$ $  <K ?&  <a| @y 9㿘@  㿘@ `''<\#䀊`" < "h[ @В@+i@  ?''& '̒@gߔ   ?㿘 @v <K @f 2 @vӐ0      & ?㿘@ ? " $ p$  㿘@9 B@`` & 2 @8>  㿘@9ڒ B@`` &@@`2@8)  㿈!<\#䀊 <ې"6 ''''@gm #䀊 <ʐ"㿈!<\#䀊 <#6@ h `D ''''@gP #䀊 <#(p А  ''?'5<\䀊 <#@6@ h`D ""''ܒ@g, 䀊 <#X@``'p'x't'P'T'X'`'d'h<\c  <#pn 6`h`7`Dp &&&'\P@f # #`h `D&'T'X'\P@f #䀊 <#G߆ 'x'|'p'h'l't<\#䀊`<1#`7| '| "<   `| '|` |  | '|`| '| hp`Dh"x ""` 'd@fX#䀊  <# |t @ 2? 'p't'x'`'d'h'P'T'X3<\c䀊 <ސ# hp7`D `"""'\P@fm c䀊 <#ɒ В ?\ '  @''@8 '''''?''?p'x'|!<\#䀊 < 6 h`D@f8#䀊 < `" А `'\'   @'''@8T '''''?''?p'x'| <\#䀊`< 8g6 B"'' h`D@e#䀊 < R 6@``'`'h'L'd'l'p't'x'P'T'X'@'D'H<\c  < X/ 77@'p` @<3! 'p't`'x`h `D&&&P'\@e U c #p "'p  2`h 'p#䀊 < p #p   '(',?8'0#䀊 < 7@`h(`D&&'X'\P@e| #䀊 < ؒ`@`'p'x p't?`?P'X'\'h'l3<\c䀊 <  `h 7`D@eS`c䀊`< 㿘 C   ?@7` `$ $  $ $`$@$`㿘` ` `x@``''''''''''''!<\#䀊 <! e `h77`D """'@d ݕݒ#䀊`<!(IxВ`?''''''#<\c䀊 <!@0 h77`D """'@d `]c䀊`<!X@` 'h'p'x'|'\'`'d'l't'T'@'D'H'P'X5<\䀊 <!p  7@ hh7`D P"""@'L@d "䀊`<!ْ@` в'`'h'l'L'd'p't'x'D'P'T'X'@'H5<\䀊 <! 7 h@7`D `"""P'\@dI 䀊`<!@``'p'x'`'d'h't3<\c䀊 <! `h7`D p"""`'l@d ܾc䀊`<!u㾸 '('X'h'p't','0'4'@'H?`'l'x'8'D'L'P!H!H ` \X@?('0'4'h?' '$?p'l?H'D'x'P '(<\c䀊  <"<" <"( 4 h 7`D@cʒ(lc䀊`<"0#7d`@'h'ld'p'|< '\'`'t'x'T'@'D'H'P 'X?060 ?0/  't 't 't 't5<\䀊 <+`@"H27@hh7`D P"""@'L@cn 䀊`<"`ǒ㿈!<\#䀊 <"x h@5@ ''''@cL   @''''@cA #䀊 <" "@ p 㿘&@`@3ϒ`  @ &@$ p$  㿘` &@@3  ?` @ <#t`$@ &`<#`$@ <#t#@`#@<##@  `<#t#@`#@<##@ `<#t#@ ` ;  #@#``<##@`  <##@`#@#` `<#t<##@`! <##@`#@#` `<#t<##@` &@`` &@&``&@$p$  㿘`&@ @33   ?@`" $`p$` 㿘`&@@3 ` $@ @ `&@$p$  㿘̠` @`&@@@3`@ $  $  $ &@$p$ ` <"? , , |$x@2.` Ē@$$ȁ㿘`@`&@@@2͐@    ? $  $ $   $ $ &@$p$   <o"?, $@2 ` <" c" "   p l@$l$p㿘`&@ @2  ?@@Q&@  `&@`&@k`  <#t`&@ &`<#`&@ <#t#@ `#@<##@  `<#t#@ `#@<##@ `<#t#@ ` ;  #@#``<##@`  <##@ `#@#` `<#t<##@`! <##@ `#@#` `<#t<##@` &@$p$  㿘`&@ @1  ?@@  <#t`&@&`<#`&@ <#t#@`#@<##@  `<#t#@`#@<##@ `<#t#@ ` ;  #@#``<##@`  <##@`#@#` `<#t<##@`! <##@`#@#` `<#t<##@`#@$p$  㿘`&@ @1  ?@@C <#t`&@&`<#`&@ <#t#@`#@<##@  `<#t#@`#@<##@ `<#t#@ ` ;  #@#``<##@`  <##@`#@#` `<#t<##@`! <##@`#@#` `<#t<##@`  @հ " $p$ 㿘`&@ @0  ?@@ &@  `<#t`&@&`<#`&@ <#t#@`#@<##@  `<#t#@`#@<##@ `<#t#@ ` ;  #@#``<##@`  <##@`#@#` `<#t<##@`! <##@`#@#` `<#t<##@` ?   2 &@`&@`&@$p$  㿘`&@ @0k   ?@.@ `&@ @0Z  ?@@" $p$ 㿘`@&@@`@0C@ `@ $   @`@06@  ?@ " $p$ 㿘̢` `&@@0   @ $@ """  `2 "&@`&@$p$ ,`*`$x$|$Ē@  $$ȁ 㿘@`@ t e`` 8 <Kbl+ `@ < ` `* `$` `(` `,` `0`  8`8`  8`8` `X  8`@`$ @ 8`@`( * `H`0  8`P`4  8`P`8  8`X`< @ 8`X`@   D8```H  @  E8`h`P   E8`p@ 0@  g `" `@`"@@`" &@@<K#  <\#䀊` <#X @Q"  @@`>`` 5`@` ?@`%  @ (<@ ``T@  <@  `@`@`` ?@` <@  Բ`0<#<#ٰ?0<Ր#$$ 㾸@/ `    ?&` =   >@    @ >@ ` &` ?>`&`  >`  @ >` `h e   8 <Kbl+ `@ < &  *&$ &( &, &0   >`   >`  X  >` $ @ >` ( *&H 0  >` 4  >` 8  >` < @ >` @   D>` H  @  E>` P   E>``h 6`h  # `$@0 D @ &`$@.g`(`$`   2<\#䀊` < @.S  ?6`h   @ &` 㿘`@&@@@.<`@    ?$  $  $ &@$p$   㿘@ `*e @ 8 <Kbl+ `@ <  & `*&$`&(` &,`&0`  >8`  >8`  >@`  @ >@`$ *&H`,  >P`0  >P`4  >X`8 @ >X`<   D>``D  @  E>h`L   E>p 6㿘@ ` @ "``   >`   @ >`    @  C >`   @  B  `>6 @ d` 8 <Kbl+ `@ < & `*&$` &(`&,`&0`  >8`  >8`   >@`$ @ >@`( *&H`0  >P`4  >P`8  >X`< @ >X`@   D>``H  @  E>h`P   E>p 6㿘@ `'  D@.@`@ $@- `   `2@а?` e` 8 <Kbl+ `@ < ` `* `$` `(` `,` `0`  8`8`  8`8` `X  8`@`$ @ 8`@`( * `H`0  8`P`4  8`P`8  8`X`< @ 8`X`@   D8```H  @  E8`h`P   E8`p@ 0@ @ d` 8 <Kbl+ `@ < & `*&$` &(`&,`&0`  >8`  >8`   >@`$ @ >@`( *&H`0  >P`4  >P`8  >X`< @ >X`@   D>``H  @  E>h`P   E>p 6㿘@`@` e` 8 <Kbl+ `@ < & `*& $` & (`& ,`& 0`  > 8`  > 8` `X  > @`$ @ > @`( *& H`0  > P`4  > P`8  > X`< @ > X`@   D> ``H  @  E> h`P   E> p 6` &ː 㿘̠`  @`&@@@+`@`  $$p$ ,`*`$x$|$Ē@  $$ȁ㿘`@ t e` 8 <Kbl+ `@ < ` `* `$` `(` `,` `0`  8`8`  8`8` `X  8`@`$ @ 8`@`( * `H`0  8`P`4  8`P`8  8`X`< @ 8`X`@   D8```H  @  E8`h`P   E8`p@ 0@ "/% " < 0֒? <\#䀊` <̐ h @"?@8"*  㿘@`@t e`` 8 <Kbl+ `@ < ` `* `$` `(` `,` `0`  8`8`  8`8` `X  8`@`$ @ 8`@`( * `H`0  8`P`4  8`P`8  8`X`< @ 8`X`@   D8```H  @  E8`h`P   E8`p@ 0@  < @`@`' @`<9 .?&@@< -"? <\#䀊` <#!@X"Ȳ"<!8  Ē@i"' 㿘@`@` "`   > `   @ > `    @  C > `   @  B  `> 6 @ e`@ 8 <Kbl+ `@ < & `*& $`& (` & ,`& 0`  > 8`  > 8`  > @`  @ > @`$ *& H`,  > P`0  > P`4  > X`8 @ > X`<   D> ``D  @  E> h`L   E> p`T 6`@`&@`"@"``"  㿘@ `@ ` D@+;@`@ $@) `   `2@i?` e` 8 <Kbl+ `@ < ` `* `$` `(` `,` `0`  8`8`  8`8` `X  8`@`$ @ 8`@`( * `H`0  8`P`4  8`P`8  8`X`< @ 8`X`@   D8```H  @  E8`h`P   E8`p@ 0@t @* D@` e` 8 <Kbl+ `@ < ` `* `$` `(` `,` `0`  8`8`  8`8` `X  8`@`$ @ 8`@`( * `H`0  8`P`4  8`P`8  8`X`< @ 8`X`@   D8```H  @  E8`h`P   E8`p@ 0@ 2 @` "`   >`   @ >`    @  C >`   @  B  `>6 @ d`@ 8 <Kbl+ `@ < & `*&$`&(` &,`&0`  >8`  >8`  >@`  @ >@`$ *&H`,  >P`0  >P`4  >X`8 @ >X`<   D>``D  @  E>h`L   E>p 6㿘@ `  @` "`   8``   @ 8``    @  C 8``  @ @  B  `8`0@ @ e`@ 8 <Kbl+ `@ < ` `* `$` `(` `,` `0`  8`8`  8`8`  8`@`  @ 8`@`$ * `H`,  8`P`0  8`P`4  8`X`8 @ 8`X`<   D8```D  @  E8`h`L   E8`p@`T 0@@` "`   >`   @ >`    @  C >`   @  B  `>6 @ d`@ 8 <Kbl+ `@ < & `*&$`&(` &,`&0`  >8`  >8`  >@`  @ >@`$ *&H`,  >P`0  >P`4  >X`8 @ >X`<   D>``D  @  E>h`L   E>p 6㿘@ ` @` e` 8 <Kbl+ `@ < ` `* `$` `(` `,` `0`  8`8`  8`8` `X  8`@`$ @ 8`@`( * `H`0  8`P`4  8`P`8  8`X`< @ 8`X`@   D8```H  @  E8`h`P   E8`p@ 0@ @` "`   >`   @ >`    @  C >`   @  B  `>6 @ d`@ 8 <Kbl+ `@ < & `*&$`&(` &,`&0`  >8`  >8`  >@`  @ >@`$ *&H`,  >P`0  >P`4  >X`8 @ >X`<   D>``D  @  E>h`L   E>p 6 @`@ e``8 <K"l( <'`+@ @'` '`'`'`  ?`  ?` `X  ?`$ @ ?`( *'`0  ?`4  ?`8  ?`< @ ?`@   D?`H  @  E?`P   E? 7 K @    >0`   @ >0`@  >8` @ >8`@  >@`  >@`@  >H`  >H`@  >P` @ >P`@  >X` @ >XM  @`@ e``8 <K"l( <'`+@ @'` '`'`'`  ?`  ?` `X  ?`$ @ ?`( *'`0  ?`4  ?`8  ?`< @ ?`@   D?`H  @  E?`P   E? 7 $ @ &`@`&@`&@`& @`&@`&@`&@  > `  > 鹐  @`@ e``8 <K"l( <'`+@ @'` '`'`'`  ?`  ?` `X  ?`$ @ ?`( *'`0  ?`4  ?`8  ?`< @ ?`@   D?`H  @  E?`P   E? 7  @ &``&dA 㿘@`@` "`   > `   @ > `    @  C > `   @  B  `> 6 @ e`@ 8 <Kbl+ `@ < & `*& $`& (` & ,`& 0`  > 8`  > 8`  > @`  @ > @`$ *& H`,  > P`0  > P`4  > X`8 @ > X`<   D> ``D  @  E> h`L   E> p`T 6`  @"`"`袐 㿀#<L @ `x''+?'$`xlِ`x`x2@ $`x@ 2@"@ 2 @ &2 >@ѐ >< } >㿘<L x" P    ( (@ , ,@ % % `   2 "j #<!d<!㿘 8 2* *@& 8 D< |Ԑ! @& D` & @ @& D & @@<W#$ 㿘0  !0<3 j2Z tV%<B@K < ̀ '!i   `h`$ 2 `D `$2  < @@"   @  ?$ @@   2  8 * & 8j #<L x   2$  j # 2 @ې@_0? !0<3 * 2 0 p4 p< p` pD p`㿘 !<L  |@" @$1  | $``$ | @" <.!lb& & ``H K(  `Ւ  2& `  ``H @"q`L㿘 `!lʄ h@`H    $`D<|"P?` 0@ 2? $@ 2 hհ?  D  2 * * @  h*@  D    h+ D`  Ho`j2f '8 ''<% $ ?"@"`昔+ *@ @ "*`@  ^? $*`$ $@#!<L  |@!ڐ @#y  | $`<MD`$ |$`  D`@!ǒ`<.b$l $ L`<@bH$ Hd@! H` @. %  @ʐ  ` `?$@C?ꀦ  ɮHo`j2 8!<!昔+ *@ @ "*`<\#쀊`<"x{"@㿘  !< !Ȳ   { "!g!`"! 㿈  Ħ |<\#쀊` !<"@Rz`''쀦 ' X''`8  ਀ j7`<`8@ 3@Pq 6  쀊 <"z˒ ??ǀ? >" 0.?"+?0)@&? #?!>`쀊 <z#਀  <z#0? <z#`  %j0`<`"`8?㿈  <\#쀊`  !<#@z`@;  ''''@P< ?㿈   <\#쀊` |!<#@z``@ 2'?'쀤'X''@@P  @㿘=  6     .`%"@!$@ n H 㿘@x D㿘 D @& D㿘 `8@  @  <#z`(?  &"   &   <Z`@`@<Z`!&`8&`<&`@&`D&`4@Z H'D@T'@ @!#<L `|@ L@! <M`D ` $ $ `X`| D `@ $`|<.'T$L`<@NbH$H H@ &   &  Ѐ 2  <`y#а?㿘`@ ?&`@   <[P   6`  `` ?<yz ?㿘 T t!   `<\#쀊`< @ye 0 `<y^ @ ǻ0@ @On㿐Ho`j2 ''?"@"`昔+ *@ @ "*`   \?$$ @!!<L  |@] @   | $`<MD`$ |$``  D`@J`<.b$l $ L`<@bH$ H H@;d<[   NHo`j2} !!昔+ *@ @ "*`㿘 t!. T  !<\<\#쀊`*< hx 0%#쀊 <`А x `Ѐ  ``<0 ` <0 #쀊  <x 0x @`0@`@N@e+㿘`<<X ē*` €   ?<xw!?xs!H?2 02 0&2 02 0~㿘<3!<L`  @; `   <\#쀊`<xH"pH #쀊`<x@" `@ #`<` `b2@͐ @ & `<L& ` & ` !& 6 6a& 06 46 & L& P @& T!0 " & \& H & 4 ` <d* ax @  &"@ @# a$㿘  <\`#<w"H #쀊` <#` `w 4 ` <d*`!x@ .@ 42#  02 "  ` `? "x " &" @0 ׀㿘!<L  @'K @'*㿘<L  @'4    @'㿘<L !T!D !<@' ^   @&㿘!<\#쀊 <w>#0L @& !   2M<3X@ G#p@6 8$X#쀊 > <" w#P6T$T1!T4@[w 1.!T<L  @Z1<M046@K^ 2 @[< & <3!  @ #p$ $X$ @&qc0<#xvӒ @&d^ 㿘<\#쀊`<#v   <3 X@ #p@28& X㿘 <\#쀊`<#v  H<L<3 a@& H!0 "@& \㿘  H  <\#쀊`<#v  H?& H㿘<\c쀊  <vt#<L` @&쀊  <vd <d!x %<L*`  `<3a$ \ `*`@5  @%ߞ '<v@ 8쀊`<v9 h<d!x *` `%<쀊   82 H  \v%  `*`㿘<\c쀊  <v /<dx -<3/* "  8 $ 8 2 8*@  *x@ 1@%<L)< H 2' 8@2" \@c  uے $@ 8@ " @   @J+?$@ 2 Hɓ*<L <L@` "#p"@d@c@d@c"@c*@cސ7@cC@cΐ@cƐ@cɐ@c@㿘 0  !0<3 j2 `!<L<L`$  @$מl<a@ѐHo`j2 >?"`"@昔+ *@ @ "*H*o`@hf<\#쀊`<u!<L`Ȁ 2`Ȑ "``<3*` !*  * <L#<L"`"   '<L]5<L "`Ho`j2G V*H*o`` @7 a 1$`@s)` 쀢0<"t ,` < t"8!<L  &!T @ &!T@m " ऀ ` ``@"``` 2<&`tr"Xb #@m@g㿘<L   @$<L<L` B"ऀ <"tO <L! @lJ ?<tD"0` @v>  @v8  <L<L`̐  "`< ""`<_ @l <#t!0 <L` @#Ǟ@l7` @#㿘<L  @#<L` !<L? L"` < s#0 ` <L<L`А  <"`<s#X8`" А  Y< <L d cn! `<sҐ#$ Ho`j2X 昔+ *@ @ "*H*o`` @#>> 2 0PaY@2 0d2 0a)@ah@aԐj@aאn@2 0a@㿘<\#쀊`< sW!Ѐ <L@/<L4<3!@ " 4` aȀ@   ` aȀ@<   4`  `2  .!&!&" !Ѐ<L  "@(4 4" 㿐<\#쀊` <`h `x`|r`u<L!4 9!4%<쀊   l!Ԑ  ( , % r#\!Ԁ2#`P @  ((@ ,,@ % % `  $@  㿘!Ԣ l<\#쀊`<!r`#!р #쀊 <r! ,`%!Ԓ (,  .!р <r!t!Ҁ .?  .!  2  $` `2 "`!Ā E͐㿘` @"```# `aĀ2a`8"`82  `뀦 ` @!՞ 㿐`0 <\#쀊`  < "uhx|#`r'#\ h " ` <!|` @!Ğ t`(`P.t - `>  @!쀊  <"@q N<Z<  "<n!P<k!pi!x ` @!g<\!TA쀊 <qÐ"hV 0!Z  (@!ب ` <c"X$ $  $  $ 쀊 <!q  $!$!$!`$ &`% $  `<!P)?`|  쀊 <q~"V`l @! X<!㿘!<\#쀊  < 0`" `x`uq``| ( `P #쀊 < %" (qR ,<# &P&H@ H<aT<!p㿘<\#쀊` < 0`#0 `x`hq4`|@ .`u (`P <<!P!p㿘<\#쀊` < 0`#` `x`hq`|  @   F  @ <!p㿘<\#쀊`<#pː<L!4 '< l @ ( (@, ,@ % % ` i @k!0 ߔ l<p#㿘!<\#쀊`<#p  @ X!р` (!( lG 쀊 <p /?f- 6 << Xp| 0# " <pq p .!.!ѐ + <dؐ Ӓ   @\㿘 T<\#쀊`<pK 쀊 <pD <L!4 )<쀊 a4!Pp6 ``  @ؒ`?   쀤 2  쀊 <p 0 6 !#耢  #p@j!,!y㿘<L!4 #<<\#쀊`4aPo `   @`?   <\ T !`` $`@4 <\'<#쀊`4Po˔ `   @m`?   <\ `2`R# ` $` @>`     ` @+@J㿘<\#` !<L!4< ` ao~!4 "41!Ȁ%<3a ! #<쀊 a !oj!Ӏ  !4!4 " !4!Ȁ"!4ᘀ !4 " 1!Ȁ<3!"@1#]ދ@]@]@]6@]|Q@]t@]w@]d@]gW@]T@]W@]DB@]<M@㿘``#T`2`  @w``?`2)`@<`@<"!T@`2` Q  `<!P@$`$`$`$` `$@&`<$`p$`㿘`T` #< 2  @1 `?`&@ap 2 ap㿘``! 2  2   &@@`8"`8 @耦  㿐<L ` `4'!T  <  nB#P<+aҐ %<`   8@@ؐ  &@`  & ($`d$`p <<!㿘<\#쀊`<n #<#㿐!<\#쀊 <n#@<L&`&``&<<!\c(&  & ` w#쀊 <#mܒ!<@T& #쀊 <!<mА#?@<#㿐<\#쀊`<m @<L&`&`` &`  <<!\c & W & `e` @!<& #쀊 <m (@I<#㿐!<\#쀊 <m H@<L&`&``&<<!\c&  & H` @!<& #쀊 <m^ h@<#㿐!<\#쀊 <mN @<L&`&``&<<!\c&  & ` @!<& #쀊 <m) @<#㿘@&`&`&1<\#쀊 <m ` & #쀊 <m  <#<\#쀊`<l!P @5 <\#쀊`<l!(P @  <\#쀊`<lӐ!HPE @  <\#쀊`<l!hPe @ <\#쀊`<l!P @ 㿐<\#쀊`<l!@<L&`&`` &`  <<!\c& + & @!<& #쀊 <li!@<#㿐!<\#쀊 <lY!@<L&`&``&<<!\c&  & @!<& #쀊 <l3"@<#㿘<\#쀊`<l#"(X&`㿐ǖ <@9<#㿈!<!D  ' ' ''<\#쀊`<k"H @2 ꀢ#( `  < k"h<(c'T "<L`K<L `<` '`@    " "<@4<#㿘  !<)!D  $ $ @ <h  <<##㿘   T<\#쀊`< "k  ` 8 * 2 @00 㿘<\#쀊`@ !<ڕ#Ȓkg<M 8 @ <d b,@ c @ Fc  c쀊 @ !<i#k;<!P Ԑ <`8@ <L$ !$ $  $ $ $ $ $ $ $ $   (  c쀊 @!< k 0, $" c쀊 @<  (j&@   $ `8 @N0 P <<!X!TP`0  &`p 1+<)< $ '` &` 2 8 "82 H@ /Ր`(G ֐` j   2 $㿘<M  8 @O)<d *"@ A@`              2  2 2 2 " <L$@`@ (@ Ā`*`8 @㿘<\#쀊`@<  j=<M`8 @  ? ?&      <L"`@ (},8 3 %8 0#쀊 @ `!<` 4 P`j`` <d* b   " <i p8 @e㿘<\#쀊`@<iߐ  4 㿘<\#쀊`@<iҐ!'  <!@iɒ 㿘   <\#쀊`@<!pi ݐ<3!!& \XN@W@X@WF@WT@Wݐ@x@\ ? a 0" ''''@R '"?''@> 6 <"i\㿐<\#쀊`<"iQ  є  " 8<"iC 0 & D& 8㿐<\#쀊`<#i2   6 8<# i' 0*@& 8㿈  7'7 @M  <<Mc@ @=s       & @M?㿀<\#쀊`  <#Ph <4`4`cx `4`@{@n? <.?@nb ?&@" "`(  " """ &@$p$ 㿘@&`&<\#쀊`<#h  @ "㿘 <M *    1<3<5<7<9<;<<#<%<'<)< !< < < < $aP$$h%!x$!| X#at"`! &!d&a&&l'!\'ap@ aT㿘@㿘@`P@n|?  & `@ $@n?`H   (#@ 4  , $  & ( & ,@  <#&  ("@ & 㿘` &`@z``  <` &a` ) `` %  <#<#t"@  &@m`X 2 ( & ,#@ <#&  ("@ & 㿐@  ` &@ے  <g!  &@*  @ `D @`\@m$ 7 @` `<!hg͔  &@  `$ $ @m`H  H @l $ @, %$ , $`@`$ (@` '@? $ ,#$ ,  .  "  :`@   㿘M      "  :`@ "  㿐@  ` &@U  <gg!  &@   @ `G @`&@`\@mo$ "7 @` `<!hgD  &@  `$ "$ @m8`H  H @l $ @, %$ , $`@`$ (@` '@? $ ,#$ ,   .@ &`@ &&`&@:    㿐@  ` &@ג  <f!  &@ &  @ `G @`&@`\@l$ 7 @` `<!hfƔ  &@  `$ $ @l`H  H @l $ @, %$ , $`@`$ (@` '@? $ ,#$ ,  .  "  :`@   㿐    &@a  <!fs  &@   @  B \@l$ 7 @` `<!hfU  &@  `$ $ @lI`H  H @'l $ @, %$ , $`@`$ (@` '@? $ ,#$ ,`    ."@:    㿐  @ ?$`h@  ` &@   <!e  &@ <  @   @l$ "* @` `<!he  $``@  `$ " @kג`H 2@  &`@&`&@:    㿘&@`@ ` @ `2  <&@c &``&@:  "  㿘&@`@ ې` @ `2   &@`&@:  "  㿐$ @k 2   &":    㿘$@k    &  & ":    㿘@  ` &@ )  <e;!  &@ x  @ `2@   & `&@:      "@ :`@      "@ :`@"    "@ p  㿘`&@ @ 8`  ` u `<#t<#$o  `&@$`p$` ?㿘@  ` &@   <!dÒ  &@   @  ,?@` && `@  @X`@`@j& ``?. $ . %. %@& (` ? & ,#& , 㿘`&@ @ ä`  ` `<#t<#$ `u `<#t<#"@ 2? `<#t<#"@ &@`&@$p$ 㿘`&@ @ `  `" `<#t<#$ u `<#t<#"@  `&@$`p$` ?㿘&@` @ M` @ `    &@$ p$ ?㿘`&@@ 0`     $` &@$`p$` ?㿘   "@$ p$ ?㿘@  ` &@   <c!  &@   @ ` @& ? * < <M(㿘<M@ko# 㿘<@k"㿘   &`@ h 0 <#c{  &`@    㿘`& `@ ``  㿘` @@ B `@&@< cS @   @ @ ?㿘@`& @@ @`  㿘@i7㿘@i㿈`P@iG$ "o ’` j `H  Hc @ l $@,%,$$``@`@  ?``  @    B B  ?`&<` c?      @    $( &: c?     @  쀒@$,#$,㿘@`P@h? ) e` $ s`H 2  & (  ;  &&  ,#@ &&    ("@ :  &&  㿘<\#쀊a< 0bx <` &aT` : `` %  <#<#t"@  &@h9`X 2 (, :  &&  ,#@ & &  ("@ :  && c쀊!  < , ``   %b3 (c쀊!< b+  "@ :`@      "@ :`@"   㿘 `@ܒ `  .א㿘v " ֐㿘a   @&   ` .@ &&&㿘?   @& `  .㿘% "  ~   .{㿐  @ ?$ h  @g$ " * " MT 2@  &`@`R&㿘  < "c"L 㿘  "< 㿐 @gm$ & 㿘$@g[  & &  㿘 &  㿘㿘 "@ p  㿘`   u `<#t<#" ?   "@$ p$ ?㿐Y "t?  n& `@ X  $ `_?,$ ,%,%    ?   @    B B  ?`&>` c?      @    $( &: c?     @  @$, #$, 㿘    <#t<#"@ u <#t<#"@  2? <#t<#"@ "`"$`p$` 㿘  "  <#t<#"@ `u <#t<#"@ ^   "$ p$ ?㿘`    H  "@&p& ?㿘~   "  "@ $ p$ ?㿘W   "@$ p$ ?㿘?  & ?㿐<L ` `'7 !T  <  _"<.aP@ %`   8@F  &`  & ($`d$`p  <!P㿘<\#쀊`<_w#0<#㿐!<\#쀊 <_k#P@<L&`&``&<<!hc&  & ` & #쀊 <_G#p<#㿐<\#쀊`<_6#@<L&`&`` &`  <<!hc& _ & `ܔ` & #쀊 <_ #{<#㿐!<\#쀊 <^#@<L&`&``&<<!hc& ) & ` & #쀊 <^ِ#H<#㿐!<\#쀊 <^ɐ @<L&`&``&<<!hc&  & m` & #쀊 <^ 8\<#㿘@&`&`&1<\#쀊 <^ Xx` & #쀊 <^ x<#<\#쀊`<^z P @1 <\#쀊`<^e P# @ <\#쀊`<^P ؠPI @ <\#쀊`<^; Pg @ <\#쀊`<^&!P @ݒ 㿐<\#쀊`<^!8@<L&`&`` &`  <<!hc& 9 & & #쀊 <]!XW<#㿐!<\#쀊 <]ؐ!x@<L&`&``&<<!hc&  & %& #쀊 <]!#j<#㿘<\#쀊`<]!b&`㿐ٖ <<#㿈!<!D  ' ' ''<\#쀊`<]z! @2 ꀢ#( `  < ]k!<(c'Ր "<Ly`̐<L `<` '`@    壖 "<n浐<#㿘!  !<!D  <$ $ @n <w┐  <提<##㿘   T<\#쀊`< "(] y g<O< @  <@`@  ` ` &?1$?` @2 ?`@+  ?㿘@Д*`` & @ 6` @ 逊 &>  % <O <*`0  <@   :@ :@ ?*   2 ?㿘@ Ҕ?2&`. `@`퀢`&<O`8?`8? 8@ ?8 "`"8<O8 8 `  `?㿘<O 8 " @ 2  2 p  |@v #<"X<Òb@  <Ð"\  ː  㿘  <Oȇ( `2* ?* # <O ȅ( *  (  *"@㿘<" 21<P#ȁ㿘` "<  ( ` h ` `??" "29? &@4 d ( 24   "( T  !! ``  < "  ?T  !! ` ?p h D '`$@'ഐ <<Òb@0   ٷ / `!@ϒ@H <<Òb@0*@ '` $쀢` ?# ?*  *@2@ 2@ @"U@ <<Òb@0 -Г7`h 2* `$ ` 4T*  #@  D; :T  Ĕ  H 0  '2'?# %??. @   *`*  2  2` ? *  *` 2  2 # T`@ ّ. "$T*?? @ * @ +` 2` 3` ? * *@ 3 @ 2 @$`7`#'%<#<4 И h 2* ``$* @ :@  * @+@ c@@/&  쀢 $?? @ * @ +` 2` 3`  * *@ 3 @ 2 @@& $쀢 ?? @ * @ +` 2` 3`  * *@ 3 @ 2 @@"`|x5 ԕ*- @ *`  ? ? *. 2` 6  * *@ 3 @ 2 @| ԑ5x* - *` "  Ж h@2@*  $ ` T*@ #@  D; T:@  Ā2 @ ?# !??-@@   *`*  2  2`   *  *` 2  2 # T ّ-@$T (@?? @ * @ +` 2` 3`   * *@ 3 @ 2 @`&@TlЀ )7@ 73D 2? h3* `$+ 1 3h 3@* @ `*$+@  3h 3@* @ `*$+@  *  `?h 3* @ `( `$+  `?   $?? @ * @ +` 2` 3`  * *@ 3 @ 2 @@& $ T` ?? @ * @ +` 2` 3`  * *@ 3 @ 2 @@"|ԕ5 x*@ - *` T  ?? @ * @ +` 2` 3`  * *3 @ @ 2 @@| x5ԑ* @- *` "   @  쀢  ?? @ * @ +` 2` 3`   * *@ 3 @ 2 @`& 쀢`?? @ * @ +` 2` 3`   * *@ 3 @ 2 @`"|x5 ԕ*-  *``  ?? @ * @ +` 2` 3`   * *3 @ @ 2 @`|ԓ5 x*`@ - * "@@ݒԴ@}@y@@В@q@m@@@f@@a@`ȡ, h4, `@@Q@M@@@G@C@@@=@|@@8@, ``$,@쀢 "`?# @ `*`2@ ` @2 *`@7Ԑ@@@T@k@ @@H@F@@@@@U`ȡ, h4, `@@@@(@@@@ސ@@@ؒ@@@Ӓ@-`, `$,2.`Ą h 2* `@``$*@? @ ? @ *+` 2` 3`   * *@ 3 @ 2 @`h2* ` $* " @;ߒ @;ܒ    @< @< / ؒ!/ Em #0 0!/ Ee #x h`D'H'L`Ā@ ' $' " `<<HchLx@+`0'؀ " Ս /``0'ؐ !H@'H@H䀣 '<<Òch@+L@ 'L""@"''L'@ |'` $'쀢 ?# ?*  *@2@ 2@ @"U@ <<ch@+Ȑ[ 4lT6(74 D 2? h3 * `$+ 1 4 h 3@ *` `+ $+@  4 h 3@ *` `+ $+@  *  `?h 3 *` * ``$+  `? <<Òch@++T (  "6hC`Ȁ  2>`h3 *`   `$+1*@h4  3 *`  `*`$+   h4  3 *`  `*`$+   * @( 4  2 *`  `+ `$*  + `  @ { ܀`  ? ? *`* ? 2 2` ?  *`*  ? ?2  2 "܀   ? ? *`* ? 2 2` ?  *`*  ? ?2  2 `H" |x3 * + *`  ܀ ? ? *`* ? 2 2` ?  *`* ? ?2  2 |2 *`@ x*@ * "@Œ@@Ԡ@@@@@@@@@@@`ȡ, h4, `@@Ԡ@@ϒ@@@@Œ@Ò@@@z@Ԓ, ``$,܀@?# @ `2 *`@` @ 2 *`@`@]@X@@@O@K@@@D@@?@`ȡ, h4, `@@/Ԡ@+@k@@%@!@a@_@@Z@@p`, `$,2@/ Ą h 2* ܀ ` $* @? ? *`* ? 2 2` ?  *`*  ? ?2  2 h3* `$+ " T @9 @9 `   @9A@9Q耣 HL 'Hj'L /`ؒ!/`B #0ؒ!/`B #㿐h?`D'X``$'H'L'@ `` ɐ ,`` !H?# ?*  *@2@ 2@ L @T <<Lc@)WLT "@L @2 <<Lc@(ؘ P?L<3C2@<3!8`   ` !!`2.@` ?# ?*  , @2@ 4 @` ?# ?*  *@2@ 2@ l +D@k "@: 2@[mX@ `0`?#?*  . @2@ 6 @H"X"@L@/  $@ $`0` `'` @ $   @a2 hF `( "hȁ h "      @as`   Ȗ*` YX@ WX"@L@/  $@ $>`0` ǡ`'` @4 $˖   @ 2 h  ( "h)h "      @a` *  >*` !,`A% #02` ?# ?*  *@2@ 2@ $ 2"% X <` ?# ?*  *@2@ 2@ D@ @^ Ȁ(#% "XT` ?# ?*  *@2@ 2@ XD@@A d ` @% X@e Ͷ Y``` I'` @"`( Nj  @u"`  @Q2 h5 ( "hqh "      @`c` r   dž<R`  *``?#?*  . @2@ 6 @H"X"L@@/  $@ $>`0` Ƃ`'` @ $w   @2 hΒ  ( "h h "      @_`    *` !,`@ #'@zv0 `0!,`? # 㿐 hD&  $' @P |H5 x* - *`  *q   T@ %@ e  '`` $`?# ?*  *@2@ 2@ @"U@ <<Ð`H@&E  @ @  ```І8 h 3  2@* @ @$  : `@  <`#?# ?*  *@2@ 2@ &` T"H`4  ```І8 h 3  2@* @ @$  : "#@`@  #@,``?# ?*  *@2@ 2@  ,`<<Ē`H`@&,``?? @ * @ +` 2` 3` ? * *@ 3 @ 2 @@"$$@* `?? @ * @ +` 2` 3`   * *@ 3 @ 2 @`($@`  Е2` h 3*  ` `( $+ `* @ *``$?? @ * @ +` 2` 3`  * *@ 3 @ 2 @@&`$ |`5  x*-  *`  ?? @ * @ +` 2` 3`  * * @ 3 @ 2 @@ |` x5* - *` "  ?? @ * @ +` 2` 3`  * *@ 3 @ 2 @@"`̐@4Ԓ @4ђ    @4@5 -㿐 h.``̎ `D`$ ` $ ?# ?*  *@2@ 2@  T?# 4??+   * * 2`  2    +  H  @ ?#@@ :&@ `̓.` $   ?*  *@2@ 2@ l? 4#!??+   * *@ 2 @ 2 @ Q  + ( ƒ@1 ?#`@: `̓.` $   ?*  *@2@ 2@ &? 4#!??+   * *@ 2 @ 2 @    +  Dz` @/ @'` $ ?# ?*  *@2@ 2@ @"U@<<Ò`@$K<#?# ?*  *@2@ 2@ $  T @? ?# 4??. * * 2`  2  @`@  @@?"  @y T  4`H Г2 h 3*   `( `$+ @  +@  T  T" $?? @ * @ +` 2` 3`  * *@ 3 @ 2 @@$ $?? @ * @ +` 2` 3`  * *@ 3 @ 2 @@% |6@  x*.@  *`  ?? @ * @ +` 2` 3`  * *3 @ @ 2 @@ |( x6@* .@ *` "   ?? @ * @ +` 2` 3`   * *@ 3 @ 2 @`#@?'  4,``H  Е2` h 3*  ` `+@ $+ *  * $?? @ * @ +` 2` 3`  * *@ 3 @ 2 @@$ $?? @ * @ +` 2` 3`  * *@ 3 @ 2 @@% |6@  x*.@  *`  ?? @ * @ +` 2` 3`  * * @ 3 @ 2 @@ | x6@* .@ *` " ?? @ * @ +` 2` 3` ? * *@ 3 @ 2 @"#$@* ?? * . 2` 6   * *@ 3 @ 2 @+`#@2 @2 `   @2C@2S -` @㿐 h D Ā '  $`$ ZT@.Tl  Ѐ`)672D 2? h 3*  `$+ 1 2h 3@*  @ `*$+@  2h 3@*  @ `*$+@  *  `?h 3*  @ `( `$+  `?  @2' ?lT6 &  5 D Ȁ  > h@2* @`$* 4* h0@ 2*  `* $* @  h0@ 2*  `* $* @  * ++@ h0@ 2*  @`+ $*  * +   @?``?? @ * @ +` 2` 3` ? * *@ 3 @ 2 @$` ?? @ * @ +` 2` 3` ? * *@ 3 @ 2 @$  H| 2 x**  *` ` ? @ ? @ *+` 2` 3` ? * *@ 3 @ 2 @ |x3 *` + * "@{@Ԓ'@uԠ@q@@Ȓ@i@e@@@^@@Y@ Ƞ, h4, @@KԠ@G@@@A@=@}@{@7@v@@2@<c, ``$,@` ? * 2? 2` 2*  @@ @L@c@@@@@>@@8@@M Ƞh, 4, @@Ԡ@@"@:@ܒ@ؐ@@@Ғ@@@@'`, `$,2@ ē* h 2*  @``$*@?? * ( 2` 0 ? * *3 @ @ 2 @ İh2* @`$* " 㿐D@  ` 2 ``Б2  T @ "<P#<Q  `   h ? P ( ` *@ 0  @ ( `$  2  ? <P#<Q ?( *@0  @ ( `$  2  2 `<`<#`#\`@6? " * &``Г0 h 2*   $  `  T* @" :@         *` <`<Đ`@a?&㿈 Ğ' D'H`'P3`ܲ@`h H6@(@ ``($.@.H ܸ `h@6@( ``  $.@(..H`  H1?ܢ 'a+`' a6@H'`h#``"a@'?%? * 6`$. '@#@ T`'@ ?6(. 6`0@ &? ?2 2/@((`@6 @6`?. 0@((`@0@0 0   * 4 @ ?$@ (@ 0@@   #8/`&$0` @`,'?0 ?@` @@  ۺ/@ & $@4(@0(( $ 3?c5?@. @(`0P0`.`(60P@@0(( $ 6 H/ غ`h0(``$(P  3?c5?. .06(.`60@0(( $  5H, ظ`h0(P `` $(3?c5?@. @(`00`(.`60@@0(( $ 㿘 ̥.`.  D  `$ Ē@%``<`8@ .@ `, % `2 %  ̀%   @. ,  $  *. " ` ?# ?*  *@2@ 2@ %  `?# @2 *`@ 5  `?# @2 *`@ 5 `?# ?*  *@2@ 2@ % `(?# ?*  *@2@ 2@ % `,?# ?*  *@2@ 2@ % `0?# ?*  *@2@ 2@ % `T?# ?*  *@2@ 2@ % Ā`X?# ?*  *@2@ 2@ % Ȁ`\?# ?*  *@2@ 2@ % ̀``?# ?*  *@2@ 2@ % Ѐ`d?# ?*  *@2@ 2@ % Ԁ`h?# ?*  *@2@ 2@ % ؀`l?# ?*  *@2@ 2@ % ܀`p?# ?*  *@2@ 2@ %  .   ̑, @  * ̐?$@<<Đa(@@k㿘.` @  Ā?a D  `H  `$!@ <<Đah@0O `?# ?*  *@2@ 2@ #`( `?# ?*  *@2@ 2@ #`, `?# ?*  *@2@ 2@ #`0@+ߒ ` .` `,  "``  , ?&㿘 D H@ <<Đa e`.` ?  <<Đa@! 0U&  O!   И  *@2  *@     ?" " & $& !  6!@ !?*   ` ?"#@& Вה  Ё㿘  'Hh    ? Ĥ @ @ @ܐ  2 T< FŐ"  "@ B > D@-   ?`$# @ `  @2 *`@ $   @      @ > D& T?#`$ `  `  @2 *`@   < ?  "8@ `  ?  B`> xw  2 *@ @ /D  `  @2 *`@  `   ?* +  2` 3   H@ *`D2b T ` 2 *@   B> `,:  4   ` `  p` ,:  4  8  㿈`h Ȁ  ?# @2 *`@ <i"H  ?# 2 *@ `<Y"h ?# 2 *@   ?# @2 *`@  ? `0  ?`<2"x ?# 2 *@ $`h&`  <"` ?# ?*  *@2@ 2@ DH@<Ģ"`9 ?# ?*  *@2@ 2@  ?# @2 *`@   ?# @2 *`@ `,<`#d#h#\#`@Ϛ`?`     ,: `@C  ??`<3`@  8` `( `T  ` 'P:   h` 1?"<   <<Đc(@8#? *`*h2 <3!8`   ` !!`2 `$"* `4"`$  ,P  Ԗ?@?倊@"`  4`  ` 4 "t @  'p "t@8` @" p` p  @Rjpp`  y p` 2 p`  "w?v``$ <;@  @@@ pp  k "Y?X`$zp&@ p  @2 `$ڒ ( "`$`$@p-x" p  7   @Rxx  @`    @` " `"? ?` ` ]  x @Qؔ @` ` @`"? ?`,8$,`$@<?4<#P$8$4;  㿐  h`D `Ā  $<<ĐcH@X0{V $<<ĐcH@p0q `   ,` !H@ఀ <<ĒcH@@@ِ  '`0!,`1z #0?`` $ ?# ?*  *@2@ 2@ @"U@<<Ēc@0<`#?# ?*  *@2@ 2@ $  "<  `?5̚ h 2* ``$* :   <<ĒcH@Ր* *+ `*"`` ?? @ * @ +` 2` 3`   * *@ 3 @ 2 @`$ `?? @ * @ +` 2` 3`   * *@ 3 @ 2 @`%|`H5 x*-  *`  ` ?? @ * @ +` 2` 3`   * * @ 3 @ 2 @`|`x5* - *` d"` ?? @ * @ +` 2` 3` ? * *@ 3 @ 2 @$ `?? @ * @ +` 2` 3` ? * *@ 3 @ 2 @%|`5x* - *` ?? @ * @ +` 2` 3` ? * * @ 3 @ 2 @|x5* - *`" @& @& `   @&ؔ@& ,``0!,`0; #p'D'H 'LV $ L?!"@ DL?"hD $'& h&   ^ ,? L!#D@s`|xH4 'ԕ* , *`  ?# ?*  *@2@ 2@ 0a'H 0 ('?Ԟ#?? :$ |4 x*, @ *`    * * 2`  2  7+  D@!  ?Ԩ#??  : |4 x*, *`    * * 2`  2      v o'` $' ?# ?*  *@2@ 2@ @"U@<<Ē`@8? ' ̶?)'2 ' " +?)?@ @) @2`$* @ $@   R @ " 6 *  *@ 2  @ 2 @ `??% 2`2. * +  @ 2@ 2@ . @?   2  ` * +  2`  2   2  ` @ `  ) "@ ?܏)# 1'?+?)?@ 8) 2`$*# $@@   S # " 6 *  *@ 2 @ @ 2 @ `??% 2`2. * +  @ 2@ 2@ . @?   2  ` * +  2`  2   2  ` @ `  ) "@ <<Œ`(@E̓4`h 2* @ ``$* @ : "  <<Œ``@,* *@ 쀥 ?? @ * @ +` 2` 3` ? * *@ 3 @ 2 @쀥"` ?? @ * @ +` 2` 3` ? * *@ 3 @ 2 @"|x4 ԕ*,  *`  ?? @ * @ +` 2` 3` ? * *3 @ @ 2 @|<ԑ4* @xH, *` j"쀥`?? @ * @ +` 2` 3`   * *@ 3 @ 2 @`쀥"?? @ * @ +` 2` 3`   * *@ 3 @ 2 @`# |ԑ4x* , @*` ?? @ * @ +` 2` 3`   * * @ 3 @ 2 @`|x4ԑ* , *`" @# @#    @#@# ,H 6 $6 "& h6 6 &D`"$`(< @ @  6 (@I& & <& @<#D& 4& 8& 0 &&  (& & &!& d 2pؒ!,- #L #ؒ! #-, 㿘 h`D    @ l@ *@ @ `<<Ő`p@Z  * @ 6 >@ *  @?#?*  . @2@ 6 @ ! @@;  +&@ @ 64 >@ @: *  @?#?*  . @2@ 6 @ l * >@    ! ` @ ` @  l6 $* @ &@  +@ 6R  >@ *  : *  @?#?*  . @2@ 6 @ l * >@   "ڰ ! `@ `   >@   l3@ $* @?# ?*  *@2@ 2@  @@X  ! &@  >@*@ @:@ *`  ?#?*  . @2@ 6 @ l * >@   " ! `@ L`   >@   l3@ $* @?# ?*  *@2@ 2@  @@ Z ! `@ `   >@   l3@ $* @?# ?*  *@2@ 2@  @@ؐ , ! ` @ ` @  l6 $* @?# ?*  *@2@ 2@  @ ! 㿘`hDl'L6@- Ħ@ @ `?# ?*  *@2@ 2@ &a@$? @ @`?# ?*  *@2@ 2@ Ҁ π`dˀ`?倦'@p#@8l 2@L  "n  l6; `*  @`@?# ?*  *@2@ 2@T# 莚 "taa``?# ?*  *@2@ 2@ T &@9 $ `&@?# ?*  *@2@ 2@   T?* ``@?# ?*  *@2@ 2@ T &@7 2" `?# ?*  *@2@ 2@ $`"" a` ` <`hc$`8 ` "`@֐` ڐ㿘 hD l 6Ĵ \'H  H  @JNHH`  ] H`  H`ΰ m ʰ -` $  @?# ?*  *@2@ 2@ `#H!  @ {@@?# ?*  *@2@ 2@ @ Ҁ4΀ Hp :  H "?$?%` TH`$??# ?*  *@2@ 2@  T@@ H @  . ] H@?# ?*  *@2@ 2@ H ? ޞ@  H` @v2  hZ `( " h h "       @IHH` < <# % 8H 㿐 h?D&  `    l * @ <<Ő`@{d ?& l * @   ՘ S $@ @ 6@   6@   TĔ9  ( @ &@ 6@ ( &@   6@*@ @ T  6@  #\  6@ *@ @ T  6@  #\  @ #\㿐 '    @H`     ??& 㿘 h D  `@`H @ `<< `@ڔ0Ր @C@` @;`<* @`8`0 @@/aa   @ 2 a<< `@0@ $* @  @?# 2 *@ 6 "  `?# @2 *`@  6 $<< `@! `  @ `t?# ?*  *@2@ 2@ `p   `?# @2 *`@ 6 & & @ `x?# ?*  *@2@ 2@ `t   `?# @2 *`@  ?6 ( & 6 & 86 ( !`  !?*(  2 (+04 0      @   >   & ,?& , `?# ?*  *@2@ 2@ & 0 ` ?# ?*  *@2@ 2@ & 8 `?# ?*  *@2@ 2@ & 4 `h?# ?*  *@2@ 2@<3!& @& <`"!& D `d?# ?*  *@2@ 2@ & 耥 `l?# ?*  *@2@ 2@ & 쀥 `p?# ?*  *@2@ 2@ & `|?# ?*  *@2@ 2@ & `P ,  @ؐ? "<  &!2 @ `(?# ?*  *@2@ 2@ 6 *  `(    #     @ + ;( @ " "C "<  @ & d<Q"$& d@(<Q"& d@<Q#D& d@<A"& d@<A"4& d@ے㿐 h D  @ H @  <<Ő`( @W@ @O<* @80 @+@C    ' <<Ő`@ Ű?0@ * $` " @?# 2 *@ 4@`  $?# @2 *`@ 4` & :` ?c4`c 2 *@ `4` @2N (`?# ?*  *@2@ 21@/ `?# ?*  *@2@ 2,@*   &?# 2 *@ `4` @2 (`?# * *@  $`t`?# * *@ $`p ( 8 ?2` 2 *@ 4`@2N ,`?# ?*  *@2@ 21@/ `?# ?*  *@2@ 2,@* *`` 2 ?# 2 *@ 4`@2 ,`?# * *@  $`x`?# * *@ $`t ,` :" ?  !?*(  2  +(04 3      @   <`` 0?# ?*  *@2@ 2@ $`$`` 8?# ?*  *@2@ 2@ $` $`$` 4?# ?*  *@2@ 2@ $`$`` @?# ?*  *@2@ 2@ $`h` ?# ?*  *@2@ 2@ $`d` ?# ?*  *@2@ 2@ @&$`l` ?# ?*  *@2@ 2@ $`p` ?# ?*  *@2@ 2@ $`| "< @ @2 @ *`2`*  `  ?# @* *`@ $`(   `(   `" ` V $`( * ``;( V $ @޼   @攞 `y `( ` `   @D`    㿘 㿘 㿘 2 h h   2  2  @`& ,@ݐАP'P& h'HĐ@[  , ؀@  ,`` &` 2`-`$```4  ,  ,,@  ,  ;<ŀ` `` @D5 `` ?$@*  2  < @ ؒa  " 0  "  $ S  ,N?#6 2 `  @2 *`@    H  @᪔`? a M .` "` ``.`PI"`  @2 *`@ 1 ,  "  ` ,*    @`` ?$@*   &  2 ,-`" ` , \` .` ``.` 㿐 h`D`-?`@  !  ?# ?*  *@2@ 2@  ( ?Ð 㿘?' D'@U $ @ h``;`D , 5  G 0  $? ?'  $" C<` b<<ŒaHX@ ؖ` " `K `4  ! "d  ,! 2 $?'Z "" 4   4 ,  `% ,c< $<Ő!H  ? '.   ?# @2 *`@      @{`?  ? ' ?# ?*  + @2@ 3 @ ` -?# 2 *@ -2`) 2`?# 2 *@ `   ?# @2 *`@  ?  0  ? ?# ?*  + @2@ 3 @ Y`2   ?# @2 *`@  ? ?# 2 *@ `  ?# @2 *`@  ? "?# @2 *`@ `3   ?# @2 *`@   ?  !?# @2 *`@ 4  `$?#2 .@4 , @? <c % 4 % 8U<3a  "a% D @㬞2 '@  ( "'@̐'@'?# 2 *@ * 2  ?# 2 *@ * 2 㿘 h?`Ħ#$  T<Ő!xϘ J?#` `  @2 *`@ `` @2 *`@ ` @2 *`@ 5 &@'   2 *@ @ ` 2 *@ `  @2 *`@ 2?㿈 h?`Ȣ`Ĕ', <Q "$ d`4 "৐`@`Dݖ ' $ ?`4 $􀤠 ?# ?*  *@2@ 2@ " "7< @@* (@"( 40@$ #*@ *@ 0 @  *@2*  * * *****<3a  "a& D@✞2  h  `( " h  h "       @@`  쀢 "I 㿈 h Ħ  Ȓ?'y <  4 &@ 4 "$ d<Q"$ d@<A"$ d@<A"4$ d@<< 2 4 * 2`@ΐ`@`D '쀤` ?# ?*  *@2@ 2@ " "7< @@* (@"( 40@$ #*@ *@ 0 @  *@2*  * * *****<3a  "a& D@Ϟ2  h  `( " h  h "       @?`  ݂쀢 "''  $ ?`4 $7㹐㿈 hV $ `Ȕ?`Ā@#'?'  <Q""$ d$ ,   2`  $ ?4 $`㊐2 $ @$ '?# ?*  *@2@ 2@  " "<< @@+ (@"* 40@&(* @#* @ 0 @ * @ **  * * ** ** `  !2  *` ,<2 a 2 3 +    @'?# ?*  *@2@ 2@ `"< "< @@+ (@"* 40@&(* @#* @ 0 @ * @ **  * * ** ** 4!` 2` "2  *`<! !2 * 4 $ @ e ( "h͐h`8 # 4 " "$4 " 2`@`@`D2 '쀤 ?# ?*  *@2@ 2@ `" "7< @@* (@"( 40@$ #*@ *@ 0 @  *@2*  * * *****<3a  "a& D@2  h  `( " h  h "       @>` " $  $  `6 $qۨ쀢 "f'&b' 4 $X 㿐 h ,   Ė   2 `$ < h<Œa@Ѱ  ?# @2 *`@ ?# ?*  *@2@ 2@  @2$ @?# ?*  *@2@ 2@ <Ő!@ 2  <Ő!@`   < h<Œa@  ?# @2 *`@  `?# 2 *@  @ ?# 2 *@  ,\@?#-<ŀ`" `$   `"  4  ] 2 `$< @ 5q 0  ?*  *@2@ 2@ `# V  2 *@ @ 2 *@  , `` 8 㿐 h Ĥ?`@`D x'`?`?# ?*  *@2@ 2@  @a [?,<3`" N& D  @ޜ2  h `( " h  h "       @<` "T $ T $<< hb@ a  $a$ D`4 $$ , $<?6 $& 4& 8$ 8 Ɛ 㿐 h Ģ?`@`D p'`?􀤠?# ?*  *@2@ 2@ [T $   h<<ŒbHX@m  4 $ G<3a  "a& D@ 2  h  `( " h,  h "       @<` <- <# & 8`& 4ۀ $ ?`4 $x 8$ 8D  +㿈 h?Ĕ' '(  (<Q!cD$`d4`" ?  N  `@ N `  ٖ 2 `$`?`4`$4߶ $  N*  ?N * @v Z ( "`` $`,`@`D4 '쀥``?# ?*  *@2@ 2@<3! `""!& D@:2  h  `( " hY  h "       @;K` Z 쀢 "nP'㿈 < h  " 2V $j? @$@c?D̘ 'Y  ?# ?*  *@2@ 2@<3! `""!&`D@О2 `h  `( "`h `h "`  `    @:`  쀢 " $ $< 6 $ & 8; `& o 㿀 h Ĥ `@`D''C'`?'쀢 P'`?# ?*  *@2@ 2@  @;@  D '䀦`2 "' "<  2A䀦`?' ?'  }줒 `$  ?# @2 *`@ ` ?# ?*  *@2@ 2@  @?ဦ`'V$ @怤䀢  D@'䀢 <3a  "a&D` ?# ?*  *@2@ 2@ "@7<kሀ``$ & D`$?6`$` &`8y & 8 & 4qM`$  ?# @2 *`@ `?# ?*  *@2@ 2@ #@  @۬2  $ ( " $̐ $ ?`6 $7`" $`$`?` 6`$,  `6$#  @~2  hc `( " h  h "       @9`    @V2 h; `( "hv h "      @9h` "'w '쀤耢 "䀢 㿘 D'P'T'X $  <d *`ѐ @    . & <d"Ȓ@͔P! ``" `"  0` `"  0!<V"( !<M"+"ȁ㿘 D'P'T'X $  <d *`ѐ @{  . <d"Ȓ@ƒP `2.  !<Œ` "#& *㿘#<dbȒP'P'T'X@v !<"*ߖ㿘 <Ţ c @: = <. c(@$ O<@<Ő 8&@c0@ <@ ~&@c8@ <@ @t&@c@@ <@ j&@cH@ <@ `&@cX@ <@!V&@ch@ <@"L&@cx@ސ <@$B&@<#c@ѐ 24<@<Ő ?&@c@ǐ <@ +&@c@ý <@ !&@c@ó <@ &@c@é  <<*K#@` &@  8*@ 0  c @ d 㿘 DP Đ@ @Ϊ?wǒ   :%HTLP@;%@ @ ߖ x@l H4* "@@FT H w*  a& H     ̓," H * ̤ ? " "  H 3?@#bU @ഠ<8@, ,    ̕, ,"@  ̀ `$  ?*  *@2@ 2@ H*  ?  wC   $$ 6!+ " w ̀ !H   ̑,@ "HH  wސ  , w, 㿘 D P@? H@$T@LP@z% @ @y@ ڒ @  @ T@@ @! @` Вv,` w`!@ `8 H Г,` w``,`H @ ̑,`@ "H7H`@* wp wn㿈     ^ .   ! &!`& ! 2!< X'2 ! <( p!`&!! v & D`j 0! ' "J< " 2<u" @$o<ƀ""W<!C<g"$$a<Ɛ> &%``%`ha0< (%``%`h b@< (%``%`h`@%`P%`tK%a <$ (%``%`h%`P%`t%a  2? <0!H$ (%``%`h%`P%`t%a  20 <!!p8( (%``%`h%`P%`t%a  2  <! $(%``%`h%`P%`t%a  `!0<Ɛ!(a `& "(Z 0倦  @a @ T Ր$`h: * `@":  $*@ ```8 d$ b\F $*` !T  @! ! ' !" <a 8<@ qa  %a ("` 0?# ?*  *@2@ 2@ %`L` 4?# ?*  *@2@ 2@ %`P` h?# ?*  *@2@ 2@ %`t` L?# ?*  *@2@ 2@ %``` T?# ?*  *@2@ 2@ `L@ %`h@<'"@7`P" dh<'"p*@`t" @ `P;`t!@`=bd2T<ƀb"8 d" H`? H`?# ?*  *@2@ 2@ ` ?# ?*  *@2@ 2@  !8" <L р   ? *` < *` 4< "< "<Ɠ:`'7" #'2 `&  4`?# ?*  *@2@ 2@ & ` T?# ?*  *@2@ 2@ <Q#. & & `\?# ?*  *@2@ 2@ & $` ?# ?*  *@2@ 2@ %`(` ?# ?*  *@2@ 2@ %`,` ?# ?*  *@2@ 2@ %`0` ?# ?*  *@2@ 2@ %`4` ?# ?*  *@2@ 2@ %`8` ?# ?*  *@2@ 2@ %`<` $?# ?*  *@2@ 2@ %`@` (?# ?*  *@2@ 2@ %`D` ,?# ?*  *@2@ 2@ %`H` 8?# ?*  *@2@ 2@ %`T` <?# ?*  *@2@ 2@ %`X` H?# ?*  *@2@ 2@ %`\` L?# ?*  *@2@ 2@ %``` P?# ?*  *@2@ 2@ %`d` T?# ?*  *@2@ 2@ %`h` `?# ?*  *@2@ 2@ %`l` d?# ?*  *@2@ 2@ %`p` l?# ?*  *@2@ 2@ %`x` p?# ?*  *@2@ 2@ %`|` t?# ?*  *@2@ 2@ %`` x?# ?*  *@2@ 2@ %`` |?# ?*  *@2@ 2@ d%``8 ` ?# ?*  *@2@ 2@ %`` ?# ?*  *@2@ 2@ %`` ?# ?*  *@2@ 2@ %`` ?# ?*  *@2@ 2@ %`` ?# ?*  *@2@ 2@ %`` ?# ?*  *@2@ 2@ %`` ?# ?*  *@2@ 2@ %`` ?# ?*  *@2@ 2@ %`` ?# ?*  *@2@ 2@ %`` ?# ?*  *@2@ 2@ %`` ?# ?*  *@2@ 2@ %``!X?# ?*  *@2@ 2@ %``$?# ?*  *@2@ 2@ b %`a`d`<@ '<'@8'<'`!?  !?*(  2  +(04 3      @   b =`a`d`DH 'D'H@'D'耦`!?  !?*(  2  +(04 3      @   =`Ȁ`L?# ?*  *@2@ 2@ %`Ѐ`P?# ?*  *@2@ 2@ %`Ԁ`T?# ?*  *@2@ 2@ %`؀`X?# ?*  *@2@ 2@ `d `l+``h `P*@ `(`*`T2*@ *@???%`%`%`%a%a%a%a%`%`%a%`%`%a%`%`& & ĐA 0  `& ,N  !.  #0`@ʐ`"6 q͐6 !. v # 㿘 D$h:@*` ``$8$ $ @ Āp <`#?# ?*  *@2@ 2@ '" $V`?# ?*  *@2@ 2@  !8" " !+0;$07`?# ?*  *@2@ 2@ %#8`?# ?*  *@2@ 2@  `?# ?*  *@2@ 2@ #H@N . 㿘  Dh@,q2 D6 㿐 D$`h`: *  `$```$8 !  ȴ  Ĩ ' ?ꒊ'@<"#8?'&!@ ` @`v@,< #?# ?*  *@2@ 2@ "$ $V ?# ?*  *@2@ 2@  !8" " !+0;$07 ??# *  *@2@ 2@ %%!8 ??# *  *@2@ 2@ $ ??# *  *@2@ 2@ %!H@  .   <"!#h  2 <"# ?&  X DF`!T`$  ?`D'?# ?*  , @2@ 4 @?# ?*  *@2@ 2@ `l d+'@Ť@`X  d@ŝ@`X"@ '`@`H'̀?# ?*  *@2@ 2@  'Ѐ '<;@ @Ӓ  ?㿐  @    擖 2`$Ɛ? Ԍk`㿐  h     @   m 2 `$ . ,   J    J 2  <;@  @s  2?B`^㿈 h `D `'P , @Ŭ?l !*@    - ''   l74''_l5*  ?# ?*  , @2@ 4 @`2 <<ƒcԐ  )?#`@P    @ ?*  *@2@ 2@ @֐  "   *`$ @, "@& @@< m;?* ?c ?*  , @2@ 4 @`OT :2%@c`@P    @ ?* * 2` 2  @   )' & "T T *`%@ @ " & @ͷ" T$@TT **cl7*  ?# ?*  , @2@ 4 @`2 <<ƒc 0?#`@?P    @ ?*  *@2@ 2@ @   E' B "   *`%@ @- "@& @=b㿐 hĮ D ` ?# ?*  *@2@ 2@ 2L% @}`'?# ?*  *@2@ 2@ @۰ 0 2 ,' L?@ @"  @w 5?h`6@ P*` 2 ?$@* @@?c ?*  *@2@ 2@ O`T @:0$P `  `  ?* * 2` 2   * W '"Tb T`@*$@   $T̐T @ " & @s䀦@*h Ƿ @*P?h2 ?'?#?6@* @$*``  * +  2`  2  @`@ 6@@*+ h@ `# ?# ?*  *@2@ 2@ ' @ " & @Tb@' h "    " @   @;@K@Ӱ㿐 h D L ,?@ @@"  ?# ?*  *@2@ 2@ `2Lɰ  @+'?# ?*  *@2@ 2@ @@ 0 2& 2?#h4 P*` 2 ?$ * @ @ ?*  *@2@ 2@ `  , @ F@   Ԛ *P?h2 ??3? 4*  $*`  * +  2`  2     4 *+ h@ # ?# ?*  *@2@ 2@ & @ " & @"Tl@' h "    " @   @E@U@ݰ㿐 h D ,`L?@ ```   Ē@`` " @"   ؀  ?# ?*  *@2@ 2@ 2`L @-@ '?# ?*  *@2@ 2@ @ 0 2`%@ @ :!``h`?3@* ``P@2` @ $, * `  @ `@ *`h` @*`P?`h2 ??'?3@*  @$*`   * +  2`  2  @`@ 3@@*+ h@  # @?# ?*  *@2@ 2@ %@ @a " & @3`T}@' h "    " @   @V@f@㿐 h< D  " (e #a Т )< "  2   ܐ!F ` ِ2 h ,h@$:@ b "#P $"@@C  @  (  < "#h#& 4& 8P ,  @? `&!ɛ㿘`7 h62 (iǒ  "-  &&  .`P\6`,  $  *P  ,   "@0  . @    .  㿘 `23  h6`8-  &&  .` P$6`,  $  * P  ,   "@0  . @   .  㿘   ,  @ "    , j 㿘   @  "$$ `@  㿘   @ ,`  @H2  , ( " h `@ ,`㿘     , @    , 㿘  ,  @)B , 㿘    , @ `" C   ,       *` 8`@ **` 㿘    , @ " @   ,         *``@ 0  㿘 h*@ 8   P8,``$@ P@ 㿘` h*@ 8  ` P8,`@$`@ P 㿈  `h   D "`<`c ƀ 4  >  `<ǒ` ƀ ' < >  , ?)< @ ? @@Ґƀ   < >    "  hD (  `?㿘 h<R D`0`D&`P  &``@ `02`D  `D`.`@ ϐ '*: ?ЖJ?Ѐ` +  * @@  `+ ` @`&`` "``zź 㿘 D  @: %< ,`@ "   $6 $ `@*   "@   D "`hR hP㿐    ! ` <Z`@@D '*@ '<ǒ`H@+ <`"S J@ = @K J@ 2F 4 `P@ <`": J@ $ @2 J@ 2-  @`X % `!J@  @ J@ < <ǒ`@ @Y  =/6`&` &`6`6` 㿘   ΐ .  ! ,`2e $g  {v!!$@$`$f  $` gn`@8*`<R$  ђ`L& $& . & & D& , 0!. P #   , 6?D <* `3 , E  ". z. <RH !& ,H`$``D`"`$` #"H?!. 0& 0!.  #000ߐ0*6 0< 6 gM 6  0!.  #6  X ђ$ ?'''''̀ '<;@ @  ?`h<D$"`d2`"2`$"`,`"`4"`<"`8"`0"`@2`( 2`&<Q#؆ 2`$2`" "`d<A"`d2`"2`*㿘<R H(. D `2  >  "  " 2&  "  2( $@  2"2$2* " 2D㿘<R H .  D "  "$ <2$  2 D  4 L d |  $ @ \ t㿘?" <; @V ? 㿘<;<   ? 4?ꀢ  @/  ?&㿘A Cd l6  *   * *# l`  " ,?Ç $ ͐l6  *   * *# l`  " ?`.  $`l<R`"     < $ 4 $ $㿘l    . @   $ 2 ?&@  ` ? ` `2 ?&@o < & 㿘9 0! *2"2& 2(& "<R&  "ࠒ`& & & & "İ ?㿘  &    €  <Q <R`Đ?"` 1& 㿀 @)''`` ' @  ` <쀢`@㿀@   @@ &`  " 2`쀢 ` &`쀢 @0 ?c  @h쀢 @??p ?2    $`2'''  @'''''аp ?2   $2` `@ ''''А '''''dذx''''''$2  @` 'P0t؁㿘  `$㿘 `` 㿘  @ ? 0<p! 㿘   d  2`??`    `0@{    2   $ eS "$ $$$ $"  y$@eA  0 @מ @ @㿘 "$?  `?"  ``"  "   @2   @*@&    x<*!   <ǒa(@=ِ (?р  ```` ?ꀦ?M 24 <̐!8? & Z㿐0  !0<3 j2  ` l    . @" 0?  !0<3 *0*0㿐0  !0<3 j2  ='?' 2 * ``€ '<; ?&  '< ?&'"  ` "0~v~t0? !0<3 *0  !0<3 j2; nt xݔ  't  't 0? !0<3 *t㿐0  !0<3 j2 A    (€' 0? !0<3 *0  !0<3 j2 t B?E't ; 6   ='t   $ 3't`,'tl    *@`&  x p  p}tȐ?kj 0? !0<3 *t00  !0<3 j2 t x+  't   `$'t7 0? !0<3 *t0  !0<3 j2j t x  p 'tp 't 0? !0<3 *t0  !0<3 j2? ^t x  p  'tpۖ't 0? !0<3 *t0  !0<3 j2 /L #P 'P?`'T'X'h'l  '\x 'L'X  $@ 2@'pzX'L 0? !0<3 *L㿘  0  !0<3 j2 L '  P'''''''' `$ 2@aЀ  'L  ԐS &'LO 0? !0<3 *L㿘  㿐 601?  !0<3 j2  ?#@2  @q ' 0@' 0? !0<3 *㿐0  !0<3 j2U d ?#@2  @ ' 4@' 0? !0<3 *㿐0  !0<3 j2& 1    ,€' 0? !0<3 *㾐08  !0<3 j2 <;@? ' @ڔ    2[0 T?ꀢdN'?'` *``@Ք  Bx@ Q 4' ?ɀ /' `@  &@?'< @@ ''` $@ @''`@”@`@1`0? !0<3 *㾰0  !0<3 j2 <?@; '@W    2T0s M?ꀢdG'?'` *` @R  ; `@ ˔ *''  $@ @ ې ' ͖ '&`` '"&``'' @@ 0? !0<3 *㿘 `   `?`8?㿀? <R?  <;@  @ϒ ?{?`u< *` € ْ k ^ e   _  Z  T ( N Q H  A  :  j2  +  # T      d    ?㿘`<<!*`"  !X ?Ɂ <*   ?㿘<R Ġ<ǒa@&@ &&@2 0?2 0k2 02 0逐2 0 2 0f2 02 02 0瀐2 0+2 0w2 02 0Հ2 02 0y㿘,?1<R! @X<e+H`4 "&@$&@ ! @! 㿘 <R0?a"@ @ 0#a @ <e. #H@ @@"@ a @?㿘<e#H.  <e  "  2 <e"ȓ.  㿘<e#H.  <e  "  2 <e"ȓ.  㿘<e#H.  <e  "  2 <e"ȓ.  WG@D_@<i@?l@,}@㿀 , xR O?<;<    ? > @ " "v "c "/("9?0)I?0&"t l?0>?0 8?0 jR?0`;<R``&?0?֐`?T@ !! `2, }?, }, .,"b, {ڰ<R! 8+ (*($ l"@˰!$8+ !*!$ 4 @h, w, v, zT@ !! `?$"\i @4    ? , x , x$ , |T@ !! ``v??$ 4  < @ `? 0 @a <z`` @l @gO@АO $ @W 2 47?$ 1?<? @”    "@ "p "?$"p  `*   @- @( ] 㿐<;  <    ?  ?t" i"~ "=?0GH?0"8 b U?02@i?0`".l4`Q;?0R P?0"&` ``?0s;8?0l }I'G' {,* B'4?' .<' w!* 7'P z1'Tz-' v*  z* \$' x * : '' |* : ' '' ''   ` d @ 4 `  <@ݔ  "< ??'`? 㿘<ecȠY "6 ,@y#6 ,㿘#`""p@"p `*   @*  @%2&"p\&"p ` :  :  <e `<ǀ`" ` \:`<ecZV㿘  x P@"@㿘  x`@@㿘 P P  l :   @`   P x@<ǐ & & <bX`$ "`$ 㿘' P P  l :   ?'@5   P' x@<ǐ & & <bX`$ "`$ 㿘 @ @  4 :   @    @ x@h<ǐ!& & <bX`$ "`$ 㿘 `  `@ <R: a0 6  `@EZJ  @P<bX`$ "`$ 㿘[ `@?   @ @ 48, 㿐"''*@" 8H/`<9#D@h` '"$cD    P! P " l  l:    "P   !H`cD@h` `2"`$cD㿘"P |2(' #? ǖ   h "?  " >sڒ' 㿘 *# &</ D @o  `D   $ @"``"@"`# "#€ @2 `D @g㿘!</ D @F@`` & D`  `  D` 2 ` "`  D @:㿘!</ D @&` & @&㿘@ 㿘 `D`D<R!4`PH`l@23 @@    ?& "`&""",@ p @@Ր 0`P :  :  <3`@ `@@ :   <3`t <30 !<ɐb&b" `P&b&b,&b؁㿘`< ,a* @ "c ?Ӂ?Ӂ?Ӂ?Ӂ?Ӂ ?Ӂ?Ӂ?Ӂ?Ӂ?Ӏ` `2?d "" ` "" T  ! 2" ?  ?Ӂ?ӝ㿘 t  8͒ !㿘 t  8Ò !" 㿘 t  8 !" 㿘 t . P P l  @ : *   8 !   P  l : , g  "M 㿘"t X  D # D  T # T  # <R, <R a(#  + (  # h# 4# l+ )#"#"Ѐ #"  3"`# 8" <<<<<ʖ? |#cH|#"l#"#"#"#"###"d#"h2 @0ȝ㿘 < \"` <ǘ"ؐ 㿘 < \" <ǘ"ɐ 㿘<Ra8a8<ǐ"`!<R#<R%<V` :`<ǐb!<`!<` :`<ǐca@`a@` ݓ:`<ǐc@4`4` ѓ:`㿘<3 <<*ሒb @   ` <RaD  "aD<ǐ#p #<ecU $  ?WF  <Ra< @6<Ra8& x @/!& & |& & & \. e. f& p"0 cV<Ra@ @ 㿘 f    @%2<eW |<ecVm<Ra8 @㿘  <ǐ# _ (`` @ `"& @& . g. h&& & & & . i6 v& (&  ,@( 0& l㿘<ecU * @t   @ <R. fa< @<Ra8 @`(`` @!.`e&`p.`f&`&@&`&` &`㿘  |5" 2 |P  `"@ `  &`&` \`\ `| `"@ &`\ &`<˒ Ð | `|@$"  `&`&``&`  &` l&`l t6`t (   @d&`( `,@&`  ,&`  $ 0@&`$ d!.`d&`p.`e g.`g &` &`&` v6`v &`㿘` `|`x" ֐" 2 J  $ $ `\ \ `@  " $ \ $ <̒ g` @`\$ $ `l$ l`t4 t`$ `(   @ $ (` ,@$ ` `,$ `$ 0@$ $ `d!, d$ p, e `g, g`$ `$ $ `v4 v`$ 㿘& . g. h&& & & & . i6 v& (&  ,@* 0& l㿘 ` 2 $ )$$ ?*  <;   @K ?ؐ  $   `@ `@ `㿘$?#;  8  < @ @  @ "@& &&  㿘  8@ @"@& && 㿘#?#;`   @< @@ؔ  &@`@"&@&`` 㿘` ?&``:&$ #;`@"@   < @@ &` 㿐`  '&``:&"'-;`@"@ ;  "` < @m  j``&@ޔ^'  < @R  O&@Ȓ $& ```$@< @ @3 1`"&@<;  <  ? ? ?'@Ւ @J#@'  @&`2}`'?'㿐P z@2&DD@oP'<9 }2& 2&`?ǀ   " ( 2& >?8''H`D@h`1<9`'"$D !D" !H`#D@h` `2"`$DD `#Ho`<R!4j2 D"  p @О*`% H`<R!4j2 @@  ` ?$`"`$@&& & * "HD0& 㿘 p @㿘 ?<;  @@ " 㿘 @ٔ㿘``8`"bPbP  ``@"` `  `D`D@2 Ab`  ` ` `( " `(  `P`P `l@ : , '  "b! "2 0B2 0_㿘 ?2  @< 49?ꀣ 2 $S  2&@.?#*` @`$? @ +`&?l    *@  " 2  ?` #@㿘 & ? .  u@ ?. S㿘` { y` ?``$ ? #@2_    0y tPn @E `@T@ !! `5?@"@"@"T  !! `?@ @  @ T @ !! ` ? %`  ?`" @ 8  2 `" `@ 2`S & `"@?   Q㿈`  `` @`  3$`:'`  $`'''<;  ?@     < @ @  ` ?` "@$`$` 㿘`      ` 2 &  +;(  ?$ 3`l * ` * *# l` @ " @+`   " l @``"  lR 6< 6-  < @;@ ?#$ ? < @;@  $ ?  <;  ?$     @ " & &   & 㿘 $ QY  @$  *`  "`  I I J, J@ G G J$ J J J J J G J J J J J J J G$ H J J J J J J G Ht J J H J J J G< G J J H J J J G0 HL J J I@ J J J Gh H J J J J J J GT H` J J I J J J G H4 J J I J J J G H J J I J J J G J J J J J J J G J J J I J J J G J J J J J J J G J J J J J J J G J J J J J J J G J J J I I J J G J J J J J J J J J J J J J J J J J J J J J J J J J J J J J J J J J J J J J J J J J J J J I ?  ? $  |@*  @   X    \ , @`@<А#*` €ް&۰&@٠ Ӱ`Ӑ`͐@( ưð..66 8) ) :# # "  2  8  :  "  "  }``v y pa"p^ q j``c f pN"pK ^ W@`Q Op<"p9 GE CAĒ@Ԓ@@@:9 0* .,* '@* "@ !* "@* "@ " g   0  0  t  4 ,   3*`22  )? 6$?  6?( 뀠a4`6?? Ԕ*` ?㿘  *`@ B? Δ  2 9?  `<;   @ ߔ#?!$@ $` `bp&bp ```*   @  @Pf e f it it it it it it it it f( g it it f0 f8 h f it it f it it it it it it it it it hD h| h it it it g| it it it it it it it it it it h h it it it it it it it it it it it it it it it it it it it it it it it it it it it it it it it it it it it it it it it it it it it it g h$ lt k k k k k k k k k k k k k lt lt k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k <R"<Rb""""b< (" 㿘`2 `<R"<R"" "@0<*`" @@  <@ "  <Ȑ Z㿘<m!p " @ 2 ( 2 <mp"  42(24 㿘<m!p . 2  X2  ( o h@ϒ 2 ( 2 X 㿘 @   c$?㿘 M   ? &@& &@NS 㿘 P <R" #    2㿘 @T@ !! `'㿘 <Ȁ`! @<Ȓ!P  p @^G 㿘 P  ,  `@ 2# 2 P<Ԑ#$&  P`A@6 P@<R" "#  2  2㿘 P >(#<R;?@bb :  :  "  !0`@  <O!X@ P?c 6 P<Rb " #  2   2 <R @$@@ ""@<R @`  `?㿘 <R"%%< @ $ $ @* @  t@ $ ` " `Z@$   $ , g` ``` 2``  @  2 㿘    & $ \" @"& \&  (  . g . i<!@㿘</ D  @7Ĥ `" P€ $`D @B  D  <Sc&"cD @.0* D<R"`o € @  D<f!؂D @ p @  㿘<e# `?H/`<R!4j2 ##Ԁ #2`?"`""""`"* p @Ξ 0π 2a4* <R"#㿘  <e <e# <Rc_<R#` < `P("`bT @ p @X}0T Ph"# 2& ԙH/`<Ra4j@2 @&  "&& ""*@ H`</ Pj2 <:Tb"T*0<R <"#bT @. p @@)㿘<3<Scc  @T<e#Ԫ#Ԁ@<R!41<a" cԗH`m2 cԀ@    @?""`%c$@$`$`-`x``$$` `| $` <R`"@`t`p @\cѐXc" `t )< ``@2    `  2  " * @ ,2 2  ``@2  ’  `  2  cԂ`p @czcԐcԀ@e@<R@<R"#H`</ Pj2$ <:Tb"T* <e*   ?x<; ؐ@Ȕ   ?S耢 2?@< @@    ?㿐<; @    <m5?!p  <e# ,`@   % ``,` ( 2 '<@f    ? ``@` @`2`<<` `b0@`#\`8#``,`(`0`4#d`T#h` #l` #p`#t`#x`#|`H#`$#`@`D`P `L@#`X@#0<@@b㿘<Ȣb@<map@   $ ($@&&@㿐<"T"T@<Ȓcx:#\  @U "4 & &@ '㿘 P x6 P & x?" @6 P* P2 @@ P<a#<#<Ȕ#Ȑ  㿘 P |6 P & |?! @6 P* P2 @@ܐ㿘 P?` #@ @@6 P  << P#@ 2 P@ P  < <R" " R#  2 R  2 R! a? 6 R R" b? 6 R㿘ɐ ??"@`^<Ӑ *` € R? P` #4` T`$` T` T@`ذ? Ԁ"$ T€  P <R"`# @ ``2@0 h`@  X 4` 2`? X@?`€ <R"`# @ ``2@0` X@?` `@ <Rb #  2x   2r   $` $` 4` ,` =,` <d,` Ȁ€`\ X?` T o`@0 N  J?` F o`@ @  4  :$`` 6?L$  P 0?` "(?@ <R*`" 6#  2   2 ?ݐ"@  ? Ā]x"a*a#<bL1<bL :  :  ""Lې"P0 @ @<"P #2<B~;@ ؐ@   "/l?@: : 2,?ݐ"``=<Ӑ"\*` € 2S :,<@@۔   A??T@ !! `0?Ð@ s@ %?ݐ" 8?@ b@ ۢ`2<@@   ??㿘1<e #А  &#&##Ѐ 2##Ё㿘<R#`<Q#<map ap"N?@ # ( ( & (@$@ ,?` & 8@ <m5?<m!p !p"-?@}  (%? ( & (@ސ 8?& 4& 8$@<R" " #  2   2 㿘<R#`/%<m P z@<R" #  2#<R  2#<R@bb :  :  "p !0p p2  ( ("@ 0`$ (@  ( ?2 0j2 @0܀2 02 072 0ם㿘 P  !</ D @" @ @/㿘!</  D @ p ? )$ $@ t Gx& tD @ǐ @   @ 2 2"   $ ?D @㿘<3 `<*`"  <     Eː </ D @I p `   @ƒ 2 2 "   +$   '$ 2 ` D @%?@=`,`  p @ $@$` $` t& p & tD @M  D @` F; 㿘</ D @f p "& t#< p& p  @` F͒  p 2 p& tD @_㿘</'H'T   D @9Ƹ<m!p5Tp "-(3<ɬ@/<4@X  @&  @  )<ɤ  @@ p `@ @@`x  D 24(2pT "@ D @'@@&H" & 㿘<R4#X<b b#<R @ :  "  @$ <f "$cT` cTb "`"`<3!`X@ $cT6" 㿘 p @ 㿘 p @ 㿘` ` ` `@ :   ` " D   @<3& !<<ݒa̐"<R& & @& DcP& H @_`  @Z㿘</ D @Qޤ "< P  <<<<m!̒b& @& D& <#<R cT& &a"!<R#X~<3a!<f d d$cT"`$ ᫐D @7㿘 < 8  & <  @* D  ,& 8 @2  H  2 H@ H ` @ H `<R@<RcP @D㿘 p @?Ν㿘@@6 㿘``  @ :   : '<3*` @` ,@ ,  ,@ :  2  2 2   " (   $# ` @$` `Α*`$`|㿘  @ :  < ?</ D @n~   *` ` g`" "Z ,$$  ?&  , : @ :  G    Ꮠ @ <R!4$  4+<ޗH`l2 @@  ` ?$`"`$@""", p @+ 0 ` ހ $ 0 @, , @ ``*`E<Ra4H`l2 @    ?% "`%""", p @ΐ 0Ԑ@%D @מ 㿘<3!  p@`&<  x@  t@$  |$@!(  Ր 2   x@%  B  2  @ 4"`& 4"`<<  & & P. & & 0& & @& D& L <fd $ Ē`"d㿘 @?4 4  4 4  ,   2  X@o , , 2 # @ X& `" @   "  `" @ 6  @  @)0<3 !*`" & & ,,  $@ &"@ & 㿘 !T@?4`@4`@ 4`@ `,`  @ 2   2#  A  @ $  `" !T@ !TB ,`@ $"@ 㿘 @2  2  2  * !T  @Ҕ 2 2}B$@  Bv   ?㿘 *`!T`  `2}$@ `@BS@@ 2 `*`?㿘  < ,  ,@ :  < ,   , :ǖ0_   " (ߣ @ ( 4`%<f<ޢ @`& ("@"`  @\2 (B   (`2@ T " <R `<R@<R!4H`l@2 @@    ?$ "`$""",@ p @   0dA$d T (` " 0 T"` @`2 T T (` " 0 T"` @`2 T㿘 <3 !`"    $# @  . А0    $# @   "  @ . ː㿘<3!  : @ :  d& ( 0` $ !0@   &  $ $  *` ` ? 27   ,$  ,  ,@ :  2  "    $ @ ( $@$ $ & @    $$ @ (@ , V@ 2 `*` l & 㿘 <3!< 0~   $#@ @  . >0q2  . .   0 4 8@  @ P  . Ȑ " 4 €  <R 4    @?$ "& 4"@"`"``2 T<R!4H`n2@    ?$ "`$""".p @ϐ 0  @@ J& H 4 4@ T €  . 㿘</ D @{<  `ڀ r`D ` 21   ` 84   3. . <3! @@ & H T`€  .  . `7`p @1`D}-`D  / `% 4  `,@  8$ """"`"p @q2&`Z &`  $  4&`&@"`& 4`D @^  `D  . <3!( @@ ܿ& H`D @K 㿘   2?ހ 2 o   l @ € ". . ` ހ  @    ?  ?  %<3&  ި&  @2   € 2  @) @@4.  o@ `Ѐ "&  (`"" H/ `@h` &`H*/ @`  *`" & ^`  2T   4  8 2`0@   ހ <R 4@  ` ?&`"`& 4"""2(<R!4H`l2 @@  ` ?&`"`&@""", p @dM 0԰ 㿘` o  Ð    㿘 ( ` . 2 @   2 *  $>  + @^ $4 $ $̐€  >͐  @ ($  € & ( T  T $   @&`<㿘   \"@ "  & & \  t    @  㿘 ( `< 8\<3   \" "@& \& ᘐ ڀ $  2W  `̀ ""!</ < 2!</</ D @y < 2` H [` t \   D @wy` t \   @  pT@!   8’ p @j2?S?㿘 (!</ 8 D    \"  "@& \& @8x` t \   @@  pT@  @32??㿘<3  !@ 1  `"  @?$""""`" ` @ @p @@  @  @2` 'a@W& 㿘<3!@@`@`D  p @՞*徐0&@ && @ "&@& (`` @ &(&``"`&&"`"㿘 L<  ` @5 L &  & $ ܀ € "` =A ` &&` 㿘` @  <@2 w"@@=$0@ 2@<!@㿘<3!t 8& D & "  l< D @ & & & < 4&  & & & " & "  D<f*` h* & && |"h㿘</ D @wh f <R !4H`l@2 @@    ?$ "`$""",@ p @ 0Ԑb D @ <D!`<f h @ 2w]"@@S 㿘$P;Β  G<Rcl$P@m`8`0`4```(` `,`D`<`@`H$ $8$d$$$$$@$l$$Ā  $$ 4 ,@$ `L`P`T`X$$H$t$⠐H$$\$H$$$$  3 $&` "d<ʐ!@Ȓ 㿘(0@<(#./ 00 42 <@2 62 0@2  @2 d1 *0@(")*0 0@2 @2 62 <@" 4 d" 4  d" @0ް 㿘(@0<(<@#/ .00 <2@ 42@ 8@2@ 22 @ 02@ d"Y`@@2*`0(<@%*0 02@ 8@2@ 22@ <" 4 d" @ 4"-` d2)`@@ `(<@%*0 d"@ 02@ 8@2@ <"@ 4"@` @f0@ 㿘H`!<U @4h`./ 6T7 H/`@%h`  > 㿘H`!<U @h`./ 67 H/`@h`    㿘  @  : @ :   h㿘<T"4 & h @מ<U @h` `  `@ :  B \ @ɐB $ d@<U` @Ȟ0 0 "   " ? 2? <U* ` @@ e   @ :   5 t<Va$?"a$$ H<Uj@2 " @<U ?* 0H2 ;H2 *@H(*2 x'X`'H^`  ` ? ?`?   ?N. 2L` ` ? <U`?  <U*` @@@: .<U`   "` <ʀ` !` ? ``?   ` !<f x<ʒ`X@<T"*` ]   2 t -!<V<U`   "` <ʀ` !` ? ``?   ` !<f x<ʒ`X@ɐ<T"*` (u !$`$!$@ t & & &&  & & & X<!& `.& ,& 8& <& & (6 06 26 4& d& X& \& `2 d`2 d<T"   / 2 #& d d`H & @ & d` ? ?`?   ?`, 6 6</`D @am<U @Rh`,X H26` 2 d <U& d` @Db  $ </`D @N0$ @ ͐  $ </`D @>`$ ` @6` ` ? ``?  ` !<f x<ʒ`X@ X<T"*` X6`4#`[#\#pY<Z#lH#dI#hJ"KV#t '<U75</3<U@ :  db [ 6 6D @Оm]`@h`X, H3 j5  4@ :   &`D @Ǟ5 &`2  @Ő &`D @0&`@ 2$   @B 0F &`D @`&`` @    )$  0<ʀ "` ? `?   ` !<f x<ʒ`X@_<T"*` @㺕:2Ȓ ta$?%a$ 㿀  'H @ ` `* ?"@@ 2 8 ` ` 2 * @8?``$8?H 2" `  (`  ` `  4 @ ``@x  'H`X`'H` @ ` ```H ?"?@x ", @ i  " ` $ @$@ @% ` ` ,2 +`@` ` `@B* @ 2B8 *``" @԰? `*`@ @ ` Q` H<V!D`%`d "H`@`<`@`A"`B`CKI#dJ#\3#`!<U @h`H&`@$ `d "`d`0 2`d!<U @ph``d &`d6`2$ `d " 6`4`&`< `  ` `H#\#` "u?`T 2   `" @  \$`@"$` `64`T`2 H@W   @ \ * "@@2% `$@? % ` `  "4064 ` @0,2`,  ` `@B* @ 2B8 4 ` @,2`,  ` `@B* @ 2B8 *`2``4<c4@)ېג  㿘  * Ho`<U @h``  ` H/`@h` ```@& `6 54`H/`@h`   ` 9H/`@th` `2`8  `& `2 6@ 㿈'H  `*` " `` ``b? @ `+ @  ` <V @ `*`   `H#\#` "&?<V!D`"& @ d !H @`< @ A# B CKI#dJ#\3#`!<U @h`H8& @$  @@)$  6,4`2` 4`@*  2`B@8 4`    ` ܰ * 2 հ? `` *  ͒` `  Š@ H/`<U`@h` ` @  `  `                +   H/` @h`  { @@($  @ &` @@(w 6,4 ]2` g +  2   *`?,2  @@* @ 2B8 *``M?H/`!<U @?h` ` @`^` H/`@/h`   @@(#$  @@(&` 6 4 @A 4`@7*  2`B@8 4`  㿘@ f    @ :  2 h   @  p@2$@$@&@ * &㿐 ' * '"  ````V? @     `    `     ` * ` `d $`d (?`8"`@'- `22`2 2@*  2`B@8 2  v 0 ` 2 ?* 2  ` *  ` c   H/`!<U @?h`   *@   H/`@,h` `    ``8*`"@' `8@'$ `2`4 @1- 2 2`@% *  2`B@8 2   2 ( 2 ` !@ *`2`@I- 2  @ * @ 2B8 *`` < `#X ` ? ` H `0aH/`!<U @h`  k H/`@h` `2  &   `8, "`@&`8@&$ `2`4 @2 @ *  2`B@8  2 ` @?㿐  ' g X  <m @R? * '   * "@*`2  2 8   2 * @ 8?"'?`# ` ``   ?Ḑ * 2   <U   : @ :  " ` 2 i  "0 @ i  "( @,2`"@@ @ $ ` , ` 2 * `` ` B* 2`B@8 *  " @ð? * @@`` ` ` " d ` $d44 )$<`"d!<U @h`?d $d44$ d !<U @h`+d $d $<$  y?8"`22T`2 @ ` ' * '  `*`" 2 $ `,2`"@@~ $ `  0<2  ` @l,2`,  `` @B* @ 2B8 "2 2  ` @R,2`,  `` @B* @ 2B8 2 ` <2`@%  *0 㿀 \ "& \ << 8# 9 : ; 2 =#\ >#` ?#d 4#hl#l@ & \`` @㿀 \`2& \ 4< 8#````  @ :    4< 8 P#l < 9 : ; 2 =#\ >#` ?#d9#h0@ \'P'H 7</,/<U<U  p<˒ <U<U : `: `@ ; @y<˒`@y  D @fH/`@eh` -<@@@a<f<T xbp3<˪`@4`0R   ? ?   <ʒ`X@yT* `8!<3`2``<`4#\`6#``D#dT`H#hT`J#l!`$ @y;#p<ː@`@y6P&@H/`@h` D @/!%@@@2`H/`@h` D @jD%@&H@&"P4`  <T $<T 0 <T H 㿘1<T" <(!("@ 㿘  ?<T"`@㿘ߠ  ?<T"@p(2?ꀦ <;@ @( 2!?Ѐ ?Ԓ?!' <;@ @   ? 㿘<U $ ?㿘<U $ 㿘@ph2 @0ٝ㿘  2 & e e<c0, @&e"@ ?㿘@..`@6@" 㿘 2 <ی#0W?ꀢ`<ۅ#`P? 2 e d֢<, #0` "+ e <ˑ2 ?c  ? `?   `!<f <˔ c(@w em$ <U (*`  ??+@ 6 @ ?2` <0( "   @ 2  㿘 T < `B T& T`€`"8 Ted`` <-&` e(` <̀   ? `?   ` !<f <˒c(@w~<U (*` `? ِ Td T㿘 0  @ @ 4* @    0 6* @  㿘?.@@{@ u@ 㿘 0  T `B `>`€d& Tc` ?<-$` d ` <̀   ? `?   ` !<f <˒c(@w<U (*` `? [d@ 㿘 T3@` *  0 % d"$ D` "  d D<R`R`" d$" L`  R` L <R`# #"   "  0 2  d" D D<  @ 22 d& D"& d 㿘 T3@` *  0 % d$" L` "  d L<R`R`" d"" D`  R` D <R`# #"   "  0 2  d$ L L<  @ 22 d& L$& d 㿘'H'  <<̒`@v6 ( ;<c0- @ 7<f <U?`(#-<ˤ()<  Ȁ  ? ?    * @v (@   @u  $ 2Ԥ(  Ēc0$&&H"㿘 '@ x& `@ \" @ @} |& \\&  \`@a 2 <̐ 'N ` & &  \ \ @  @& \& <    "@ &   &  &  $ & $ g. g t6 t i. i (   @& ( @4  @/  \@'"  p @t㿘#@  \  @2`  "  B "* 0B82`2`  㿘'D1<f <Da EF@u7G  J + . *`  (*JЇ8 .*`J   $J 'H   <<̒a08@u </ D @a3< b-`@ a<ծ#V    <   T-< `  Lp<̰ 8@ 88? a<̔!#\#`#d X#h #l $#p (#t t#|#x < "# `?# x#@t0@t  2``b`D @$"  H"@㿘<3! +<U-<f/<  * @ @ `h% $ 4EA  `@ :  0 ᘐ# ( "@ L @  l `@ `  4 L@@       2 4 $@`4@ @ :   @౐ @2ᘀ<U  2<U <U Ȓ z" 㿘<U</" `D @`v '< *@ z@)D @ " @ :  ੐ k 2D @`EГ*D @Ğ㿘<3!<3 <<*ሒb @   `? 6</<U x</ D @`!<Uِ  <U  "<U<U|x" & 4  <UD @{ 0 @<U`|@"@ " D @p㿘<3!<f` <U% +<U`` <U@ :  3 ``<f)<U<U :*`" *6 <U  Ȁ *#   @  ȑ: " '6 : !8!@`# Ȁ` ȑ:" : *!`  Ȁ `@ : " "`<U% :#` < Ȑ# <!b 5</3<f7<D @מ_d `Đ ,@@`!!  @ :  1  # ( "@ L @  l `@ `  4 L@@       2 4 ?$@`" :  :  Y @ @ $&`Ħ&`ĂD @w 8! <U2 `%!`: &B <3 ȑ* @@ `dD` `@ :  ' 8 <Փ! <U <U! ` %!````<U  :`@   %! 㿘<3!<3 <<*b @ -</ 1< `?D @^~."  C   d`d@  26 $@ $$@՞  @О$ D @`` @ڞ` 4h&` `@ :  ޕX&WT& Đ d`P `l ?"@^} :"D @` #<U!<U`  $`5$ $ $``` @` ` `@ :  R0s <ΐ" ?@D&@"@ @q& 㿘</ D @O]ܠ`` @]<. "@$@@2 "@` D @ :     D͐ D@ 2@ D @/x` '`4 ''''#'쀦  <  <X ܀`  2<<X ܀`  < 8@@ ?`  $ @f `   @wJ @tې     -`<<<Øc@ @ *`*2  2 2 <,@ "` d2 h@2 t2 p @2 l 2 T2` X2` 4 2` `2`    @r<U`ސ |  '܀   @{0{ @z  |ܐ!"`"`<3`L!  "`"`L"``"`8"`< "` 8`a"`@]%܀  8  `ހ`8 8 a ڀ " z   @>܀`` @6` 4,`` `@ :  `ܲ`ܐ܀ ܀` ` @ ` 2R d``1-`+㿘 .    @$  L@2 d   dÐ#<<< p   h* + 2 t@  @ 22d  㿘 (  ,<X `#<3 $a<U ,`" 8$ 0<U  0 <Ua$ , a*  ,"@@   ` @a  0a $ 0$ ,㿘 (4 * p 3   $  A p  <3!<U,0#  "0"0<U 0 "," "0  @a  p @gP 㿈<    ' ''' <<< Æ0 <( .@ 6 6 (q<U<3d2fh 2aT2]X 2Xt 2Tl2P2L.`0C/`0 "  /`0 <U (D('@/`0<U (( ( D. 088 ᘅ7 &   &2d .+`0 .`0 `C<U<3!"   "㿘   @  㿘  @`Ζ  (<3!`"  " "㿘 <`"  ` <̖"@ѻ  p @cL 㿀`l <'`Xb`d 耢  <b  ?͐ 2``   ` '@v'`` @f.` '@w” `5@" 8""`" "  2$ ?T" "  C D" " $`T"$ @"@" $"$("!,"( ?T" "  C D" !,"("$ `"P㿈<  8 (' %?  "n? t(2j?ꀢ  2c? @e '#\  @qњ <UP?<U` | <G?ɐ#!"D""d"T*t"h"X 4<m "\"l" "p"` "x"P`"L<  <("@"L8@ <X!`" <<< @ <!"@<<< 4`#@@ 2`* *@  3  3  ( D `  'Ȁ.?<<< 4`#@ @2`* *@ `  3  3 <  8 `/''''/񀢀  ?   ` @ @  <b   <b  ?͢ `"< ؒ ݰ?ꀢ`~`2<<m #\@q̀ &˰?2)'̀ À`2°?0 2 < <0"H?#\@p̢ &?2)2 t`02 t<X 耢`@ $  @ؐ`@@a @ t(2<U"?<U` | D!&X&`&d&T&h&.t 4<&\&l<& &p̔#&x&D&@Ȓb (R&L t(2Z??2Ȑ @dx '#\  @p̢ &E?2) /<U`ؼ | <6?ɐ#!&D&.t&X&d&T&h 4<m &\& &l&`&p < `<&x&@&Lր  < * "| &@&4&L֔ (&P @d,  '̰?㿘<<< 4`#@ @2`* (@ @ 3`@ 3`@ <b* @d2h2l2 p 2 t 6<32d<@8 ; `  ` ``2` `8@  <X!`" ?@ ?!" @~ @~& ( Sp<m  4/'  ''䀎' //񀦠'!<%8׀?"g?@ol ̀ 2  @2 `4'쀧 2· "O?` I?8  䀢 ? @c] '䀢 <@ `    @cH' <䀢 ' '' `4 '/_' b   <b  ?͐  '䀢   @c ' =/?ր U  䀢  '`4' '*'??# @a쀢 `@   `8  <b 䀢    2'@s1' 0`4'?  `P "?ꀢ< /֔ @ 8   /?@2`P?`P  ր  $'<U<U`(؀  2  ,Ԁ ('ؒ` | !c?$ $ d, t$ h$ l$ p$ T䀧 $ X`4$ \$ <$ `c $ x$ D<  <$ @$ x %䀢 $ x`P <!$ Dր `<X!`"@  8@<<!a$ @$ DА <<<Ò`#@@ * / 2`@ @ 2`@2`@$ L  㿘<<<Ò`#@ @2`* / @  2  2 #</`D  @|V, <"`/<3`d2&@`h2"@`l 2@`p2@ `t2@`"` @|͞` @|Ȟ @|ڞ& `2`d`D @|Ϟ㿘 㿘`? <f`́㿘\ ?<;@  @`?`?۰ 'D'P   <<͒`PX@ix</  D @|mUD@</7<32@ `( 2< bD "8 %< ( 2/ *<  , `*  0##\#`#l#d#h ᘐ" #p #tb耢 "#x  &#x#|#p@i4@P@i0p</ Ϊ`  ``a``* `(  <V", `L@  "@ `" *` * " * " ᘑ* @ ?t <3x:  " b:bЄ bЀ  `bԀ` `"ᘀ (+ "@`P+ (`P`/<ͦ@p<`:`+  /<ͦ@p<̀   "@`@``@`:`4 #\ `(#`#d#h#lᘙ3   #p ?#t#t 2 #xb耢 "#x  &#x 2#|`"#|b#| 2 #b耢 "#  # p@hyP@hu</@D@`</ D @{z%&@&P" & 㿘<V"̔ 㿘<V# 㿘<V#0 㿘<V"  <͐@h'`<V#  <͒`@h<V#0 < @ha&@  &&@ & @<V`  #\ #` #d #h $#l (#p ,#t 0#x 4#| 8# <# @# D`## H< a   #@gڐ<p#\#`#d #h$#l(#p,#t0#x4#|8#<#@#Dp##<bX H#dL#P#T#X#\#`##@g@<c4# #\#`#d #h$#l(#p,#t0c#|<Β`@@g#x<c<c<< @`@gy@&@  &&@ & 㿀<"X"X  #\#` $< #p a( #d #h #l @gP (<ΐ@@gJa@&@  &&@ & 㿘"Ѐ "&"}"&"ȁ㿘<3!&"Ȓ@"́㿘 0 0 "@ :  <3!"`0U!{   )   `€ t  "€   <6"83< t + ( <P"0*@`ɐ0'!,  (* . (8   P@ <c` ?"`  t `6 "@  0"8& <VL*  "     2   <V L( "" ( "      ` 2   "  <VL(    ) %? @` 2  "   "   "`" ` "  2??㿘 <c8 `% # ` "@ 2@  @@   U "@I"@`2` @I 㿘<V!$'D `  `?@ D@V 'D D :`<a#D `p@y DqD D D :`* :D(` ` @xD" (D ```   D (@@< @| `*` " ` , 8'<VD`4 ` @G` .LD `4 ` ` @G` `  D  @4  :* !@ 2  2   D  "@H DL,@ #  ` @2   @D " @  "   @  `*"@ *`€2`  2 D@HX  D  @W D  p@x^ G 㿀'D g  <V `` "` \`ْ2` *@ р< @ ˒ؒ"```` `B` "* `0B8*   @  <V a$ # # \ ?@ @E 'D   @ؐ D`DDD(        ~D  eD | "    f     :  2  p p @wž ['D+ i  @D ED 1`1` '<X `"  (   8 /Dڈ )<  #X    #\ #` #dD@OD DD  @V  D (@@`  "` D  p@we N 㿘 I  <V a4 @w7 &@ & & && & & & <Va4x@w$㿘m  `" ( ("`( ( "@  '<V4   x@w! p @w @wĐ`2 4 H@w 0@v㿘  <V0 < "0"<   @V. 㿘%<V<#آ4  '<V4 ,@ ,:  *` `` 2`  ?倢2%<V<ѐ#㿘 0  <V a4 0@v "C @ H `*`  <V a4 H@v '&@m' 6 & & `<  & ,& $& & & & `<` 2 ` `   ?#ؓ*  &  "(@ #  & (<Va4 0@vh  2    4    2 㿘T? c @ n`Ȓ  u)<V   `$ m$   \  $ \ $ $$ <DX$ T@l)<VT $  5@  \ 2 p @lT@ 2   (   @u$ (  $    @   `g, g`  t4 t `v 4 v22 8 # 8 p @uߞ Ȑ )<V  < `# ` `  ` `<  "`<㿘<V <V4 a4a4  `"4`<V!(:`@ $``<* 2 ` 2 ` `   ?ؑ*  "``2 ` 2 ` 2  ` 2  `? @ , `*``,2`@5`@l `  p`?@#@"@%` `  ``@& `"@  `@@<`@% "  @  $$ ($  ` "`%` `"  "` 4 x@u p @u @u *$$%%``2$`  <30&<3<V!0`   < `# ` ` " ` p @tʞ`<` "`< 㿘'D `5`,   V D D g D    (`@" T`@z  <U 2 aJ@@# lL " ` D D Z ` | "  f     :  2 "'D p @tdM'D Q? ?  !* . 2 D@6 -``\2`  , @<V `: 7D 2L * ? `` 2 LDΒ D2! :L@D   "DD D :  D :`L@  D  , 0 <VD Δ   `"  `YD ( \ @<@ `|Ȱ <( `6 t3& H/ `@sh`  ?@jN`@sh`H*/ Z  \"@  | @ & \& < tې` 8  p 0@  @s2 u| @DD ( \ @<@ .`|n <( `6 t3& H/ `@s3h`  ?@i`@s2h`H*/ Z  \"@  | @ & \& < ` 8  p 0@-  @s22& " D `"D @Rh D  @Rb D   @R[ D  p@s?㿈 , 'L @i`` @i ``*@ &` L ?@i  26``@`  ?`@@`  {?`@4f#T@f0a* $, , @fޒ#'`   @iO?0   @jؒ `*@&`.`    @j̒  * @*@$ , 㿈 @jѐ  `,&  ``2`(.  `  x' `   ` .  `@i `  4   4? -   &  .  ``E@  ` `.  `@h 45 `@   4?   & `-" $ t?  "   *@ & @h @c$ "-  & -  .  ` D   `? @h ?   ?@h ? `    @m  " @h?&  -- -    . . `   @ * &    "  -    .  㿘 ,  `$ `  2   `2 @iӔ$@* @*@ *$,,㿈 ` `( 2 `, @iʐ`     `*`*.  & @ `   P @  " `A` @ ,@  & 4 @4` 646 ` " D"`  ` 7`0" `0$` ``(`  `2 @`2`  2 ``@g `@g @  `?* * @$@& .   쀤$` ``•@$@`܀` @x?@g  @&  ` ,` @ & $@.  ɀ$ʬ` ``@4 `` `  "`  `0J+`0G$@.  `?@  &  ``I,` @$@` .  `x?@gM  ``@  @ &  ` /,`` @~$@.  `@@g4 @a쀢 `"  ` @  &  ``,``T@ !! `"]``"L@c̐T@cْa* $, , @d#'@f  @2& 2 8$@`+.  `*  `@,`   & $,` ` 2@ ` 2@$@. `2@T@ !! `"@$ ` ````%* @O^ ?㿘     ???@f@f  @      ?@h0* `#@     ?@h,   ``2  ?,  @@    ?@h , 㿘 ?    9?@g <;@  @n1 "? @fB *2*    $  ,   ?& 㿘 ,` (   ` ?#` %``@: `  ?    T@ka  2`<`@%`?  T"`, `@@  ` ?` %``@*@%`@  㿐 ,   (d g 2a? P` `@W   " `P? *  @NTF? `@9 `@e  (& (    (`P?  `` @n& (  @n`P   @er @`$@ͤ@    $ 㿘( 'D  \"@ | @ "\"<  D\?|` "\"< \ D <* @ *@@ &b. 6 b        6 b<V.  T &  X& bc. DH^6 6  "H"  `2`2  * * @& R    D?"D 4D  @M D  p@n@$)6 " ```` `B` "* `0B86 D (D@㿘 ((`<` `6 t3& H/ `@mh`  ?@d`@mh`H*/ Z  \"@  | @ & \& < \!` `8  p 0@0  @mӞ??㿘<V (``$(   "`$& 6 t L@! ` " ` : 2 7 `2 L p @m2Y U @" (  ((`<` `6 t3& H/ `@mPh`  ?@d`@mOh`H*/ Z  \"@  | @ & \& < h` `8  p 0@  @mO?8?㿘<V  $`" $ ((`<` `6 t3& H/ `@lh`  ?@c`@lh`H*/ Z  \"@  | @ & \& < I` `8  p 0@0  @l??㿐 'D`<b`'`  `$`<` @lߞ `  2b bb `d` ,D$`<   @ ` T@ 2$`<`<`` @lD " (   D\" |@ "\"<  `D<`'  <;  ?`? `<;  ?򀢠? `2ݰ?֐8 @kӰ`K< *` € ('||#   0 @dў>^"``| , ! (*@!:2  ( |  @ || "4 2<4@8|"z@'| @d|&|  `  "  ? "  ? "  ? "   ? "  ?$"[ ?2X? T@ !! `"H?" 0 @dW= <U!2`$"J  <$"\ z`` @d[ @dV$   ??<V ܐ? 8?$""` 2?ր@ ," 8?,"@ ,"<R!4 H`n@2@@    ?& "`&""".@p @d 0Ԁ ƀ?"  8ɰ?l," @ f," (<; @b`   @\ (<; @bN    ?   $"7$"@T  2 ?π`" 4 ? $"z$" o  <; @b   @[͐<; @@b    2U?򀦠#@RϐN@SBJ@  CT@ !! `?4? S)  <; @aє !?@br T@ !! `  ??y?ցH`8?Ӏ @jH<;<    ? ߔ?ꀢ`!<!ԓ*` € 0 @b:  ''"P'<9"P  }@}  (?: `@ w  @p?   j?" f?  a>$ 8H`D@`: "P $H`#D@` h` `2"`$D @_9 (>: 2"P 㿐"''*@" 8H`<9#D@_h` ?'#$cD 0 @_I 1 P ! P " l  l:    ` "P ` Ž@Ui   M ֐  @_9!H`cD@_uh` `2"`$cD㿐'' 0 @_y2 8 8H`<9#D@_Dh` ?'&$cD !!H`@_%h` `2"`$cD @_8 㿐 0 @_ 8 (>`: !  '~ ''" * "  <` `8` `4@"M`@tM`€   `؀ * "@ & ` ` 0 '`@Ǻ` ?"P ŀ Ȁ` ` 2` X``"@``\&@$``@  a0  $ %a07a0%a0` `"44`&`\@ $`\$`<%t̒ <;  @]   ?'` @W`\1$```\@ $`\$`<%<;  ``<  ?  ?'@V@X#@?'$```%``@@$`@2a0 `H ,`Ha0? %a0 8 !``0"`, 2`"   @8 4 2 X@ ` 6 @ 2 @@  @   h D 2"  @@ "  ?  \!``X T@ `H  `? !  / 8`\  8`\2 @ T    2  T``"  T X \"  L   ,`@  ? " "`T@.   `>  -`>`P@  <`  8`  4@"L @L €    ؀ * "@ & X  ,`H ,`I `H4`J ,`H4`J  X`` ``\ ` $`$`\$`<&<;  <  ?  ?'@Uy  @V#@$``?' $`` -`$`@$`<@4><6`''&"P2%'"Pz  '2'2?  ?>''`p @\??'``W!@ T `H  `? !  / 8`\  8`\2 @ T    2  T``"  T X \"  L   ,`@  ? " "`T@10   `>  -`>`P@  @\2㿘 ( @㿐 v* : `!!$ $2"Pe?ꀢ "P z^  u X? (    . uM  0 @\C5!$!6  !'/ $$!$``  $€`"  ('@ & @\8 x `& &   ? @\2??㿘% D d )`pp  @ :    ?$ """"`"@[2 Dې  D" `!``` , @  , @ `8a >㿈"P!  'H'P'X'' '"Pz  (  }?PH&Xtz3 . u1` @[)?༒ ' !̤쀋!2' 8H/`<9#D@[ch` '"&D  0 @[X4ဦ , ! D D    @   < <  "@  \@ E "/ d 耧 耥@ ǀ`"P "P   ( P u  ?ǀ  @[2"" ""*@" @Z4|x p @Z \"$  "@@ `2   v ` $?$ ` 2 * H@ @ 1@& @Z̞ ,$$ \ 7@  @ '1 / d p : @ :  $?%'  '' "`" @Z $ / d  6 `" $ " @ ` `P >?`H`  $€X X ("H`D@Z7h` `2"`&D!1 @Z=2㿘 (<V!  ( `. (   0 <c`  !,* 8 ג  P@ `<c` ?"` `" ` ( 2 `"Ѐ 2 `<V! ߻ `㿘`! (!:  0 @YӞ3` @  @Y۞D㿘!4`"4'<V ( @@ "X? 6"X @Y"L?&"L $`€<b`24$8$4㿐 0 0  @ :  <!  0 @Y}3  (  !, (* . (8 C  P@ <c` ?"` 0 t `6 "@ Dp  @ <"@"@ @ @Y`2 DI  D@    ?$ "`& D"""2` !, (* . (8   P@ <c` ?"` @ `  `@S`` 8''H`<9#D@Xh` ?'#$D @X h $@ (,* O```$@H`D@Xh` `2"`$D @X2= (  "Ѐ <V! x @X  . t㿐'' !D8H`<9#D@Xvh` ?'#$D0  ! @X{ @XX1k "!!DH`D@X9h` `2"`$D㿐 0! @X'1 ( K 5 2 @@  :" $8" $`€ (<bg"X w?`6"X<V!   :  :  @2 @W @W2_&"P 0 @W2 R 㿘!`  `@ (?<;  :  ? ? " /?" /?֐#@?4 l~  @ . / s? . / 0. / @W~1  `W!@ T `H  `? !  / 8`\  8`\2 @ T    2  T``"  T X \"  L   ,`@  ? " " T@ΐ0   >  , > P@$  @W52  㿐!` `` @H<;     ? 28?򀢠8 0?" `l"  /'?" /#?'  `?'<? <#`?򀢠  @U[ ? 㿘 w `<V!   :  :  @ @V0  w  `<Va` @V  t t ʌ ʌ    @ @ @ @ @ @ 鄔 <3 " ""@`" P@8" *0 " 㿘 (  `. )`` 6&"P = &"P!,  (* . (8   P@  `<c` ?"` `  !6 & 6 ` v  t `6 "@㿘C! T T" @``3  /.<@ *< `@@,I  \' \I.I X@8' X  <@ހ2 T㿘`  2 * ?`.À$` ``2 `@|`v<-",*` €`m` @h `"": 86:^ `[` @V 2T<V!Ā`"O.  `H. <" =.Ā` :<V!`5 23 ..&*&̀`'` @" <V!Ȁ`2 .&؀` <V!Ȁ`  ` @2  2(< v$` @ "6:㿘! @2B ` T =< ` <& j j X `, j ] 8`* @I , L 8 : *   X$ L$ `9$ d@= P  `>, j X  L 6$ L@ 02 ` /@&@" j j ( ` d$ L `@ , j$ X$ `  X  @` T T@" @  P@Œ 0@א㿘 <3!` `@@<$ 4T` \ ?$ \  2 $ `   X ?$ X Tp?$ T &$&`?"`"""""@T2T T"   ,@ 㿘!`",`@@ , D*>" "D  0 D Pb* 8 @M  S <3̐" 0" " H0""H* * ""H ?"HTH *?"X"\"D *L0?00D(  *L0?00"PP 8"PP "P㿐!`  )* ''  > "$!<3!  $   ` 2 * " $ X $ 2  ( 2  ,@(   0$ $@$ ($ , $ 0< &"T ,& 8 "@$ ,&"T > :     X   ?   "L  L d@` $ L h  `$ L4 h4 hL À  ,E T ?   T >, ?$ X8$ \625 T$ D  `2`"@ $   H2 "  $ H**$ $ H H @*   L2  2 2 @   $ P$ P P  $ P T   T T@" ? "`D@  P P"@ , @   !` " Z    T  ` Ɣ , j 2  <2$ ` @@2 $  < " $  8 "$ & $   "   } < "> 㿘 ` @ "`   " 2  ` "`  <  " `" $ $"`$ $< " " #` "㿘   25 `< 0 <0  4}@ < @€ "B `0 `0 :  6 <ǐ!&`&` `@`x@Roa  %2 @ <"x`2 @ @"`@@Ő`@ 0 ,   2`* @@  㿘<c`    $  !$  $  , (4  *4 * 4  ,4 , ., .!$ 0!$ 4 , @ S@:$$ ő2@4 8! ,  $ < Д @H P ` @H  `" $ $"`$ $< "" & $2  *  @""  p$ @ `$   "`  <$  <"@"& p$"  $ "@ &?"p 2` *   $   "`$# @ $ $ ( 2!,<c` ?"` !, * . (8 ׄ 0!,  (* . (8 x  P@ <c` ?"`  t `6 "@㿘 @&b,@`(?` '*`<-"H €`( .`(`2 <c` ?"`  @ 6``( .`(`<c` ? "` 0<`(Đ#`t b@b  ؀`+ ܚ @' "`@ # : "@` :"``@0@6  ؚ @`""` ؄" ؁㿘!؀N!`<   `@ # `@!쀢  &! 0AH!      @ @ 2&&  #&  # & 0  ؖ? ؀ * ܔ""`<#`@# ؐ  ؁ ؔ  `< ܚ   ,`@< `@ " 6  ؔ# @`""` ؄" ؁ ؆   `@    2 @" 㿘!P D@ ! "   } <ې#(  p` ?"`$  $$ ""@Px23a/" L } <#PL€  @`?"`$  $$ ""$ `` $`$$ $`"@ @$  "  <@ < @㿘!``< 2[`@``` , "b `k <   D 8<3!" D&``@` "`&@&`"`"`@$```  dL` `k ,`k` @ "L``8`\2 @  ` *@  @ $` L`€ `؀  M` @`,: @ *  $`  " `  } <ϐ# `   $` `k`p ,`k @O0 <` "` } <ϐ# }`` ,  `k `  @ ,`k$`  $` } <`<#`@ `` @ `2`L`€  $``<$``@$`&` "`&`&@"`b$`'`<  &@&`" $&` "L``  2 &` "`&`&@"`L`$` >0: <@ـ `\ \@ )`pL`€  p  &@&`" $&` " `?"`$  $$ ""@O  0  @O㿘   \2 *  a "@  & \&  2 *  \&@( \ & \&  \ @ @"* `@`@ `4@ :   @~    @<#  $ `t  b€  㿘!  ,`@  T X \"  L : T@70   >  P@  㿘``!<"`"` @@ 1 @ -!$ " ! % " !  1 !  !  @"!$  " v " @`$ "$!$$! $ 㿘  ! } < 8<"X`" @ `  ?$ @ `` @ `"`"* @ p\  $@N12` `@" `  ?$ @ `` @ `"`"2L€ 2$ @` 4`:`* @ ?㿘 < @!,   @@B @  ,  $ $ ̐  "8 L À "4   Ѐ@ <3! Ԓc"   2 * @  <c`0 "`0 `< @ `@ ,    Ѐ <3!$ $   * `<@  @2`@3 * 8!`L<`L `p @M2!u!`"S O c`0 ?"`0 @2y`@ @ @  4@ :  4l`@`\3 `*`"  !&`&`\a, $a,a($a("$a,$a( D&``"&@&`"#`@$ "€  k , k @ "` 8`\2 @   *@  @ $ ``a," * @` , @=  ,  @  `  !!@" `@ ԰ @  2а `@  @@      ,  < `p     } <  P , @ Ӑ`p!@  < } < p<0`N"0 F{`p `L @!a$" a 2`* " 2` `" @: !$a$ t`"€ x`\a,@8$a,a(b$a(@"$a,$a( ( 6!`" `k `k ,``a," * @` , @{  ,  @  `  !!@" `@ @@ # 2  `p @L8 ! 㿘``   !`<@B$@ €0;( "`L'" 8 $`<" `@:$`€ 0"` <V a @K&(& ``<ǟ@<ǐ!&``x&`  @@K˞㿘 (!   "  2  @2g @X `   Q`pY @e  ) 2Q `L @2L  :`<$ $`<`L`< `$ `< $ $ ,`<$ $`L$ (`<$!`<$! (. ( <c`  "`  L 2 L !?#, ŀ@, Ē$!L   $L À <3! $ $ @ c6  $  t 26 4"@" . 4  3< ( . (`<c` ?"` W L À "`<<3! $ $ `<$ `<`$ $ ,`<@1$ $ 4@ 8$!, ( `p  <   ,  @B @  ,  $ $ ̐  "8`@L À "4`@  Ѐ@ <3! Ԓc"   2 * @  <c`0 "`0 3`< @ `@ , `@  Ѐ <3!$ $ `@  @ @ `<    ,  < ` @  ;`p@7`p//`p!$`L (`"; ` `  Z` "P ~ "  ( . (`<c`  "` 6  $  t 2`L"@`L$  đ* $ ,`<$ $`L[$ ("  } <   @2N    ( 6 . (<c` ?"`  t <V"@8 ! 2  @2. ֐`p  @2% !,  (*  6 . ( 8 ג  P@ <c` ?"`  t `p"@`p @![a$" a 2`* " 2` `"   !$a$ t`"€  (?` 6<-"t*` €`<!@<-!  t `@`<"   "@KU `\a,@8$a,a(b$a(@"$a,$a(!`" `k `k ,``a," * @` , @  ,  @  `  !!@" `@u@X 2  `p @Im V 㿘``, `!   <V!`  $ <V!Ā`<V  !Ȁ`"`  " `L 2 L€ " `؀  * @``\"`|@ &`\&`<;Hf`<ǐ &`&`&`  P`x@I *, 4@ 2 4`` <`<* * $`@*@$` $` `,` ``24` , @@:$$ ő2@4`4``4` ``*4`:  Ő `D Є `$`@B $``""@A $``!2)<@#-"L`  `D@B $`$`Ж` $`L ! )<؀ * @Aa  "ؘ  ""ؖ``\ `,k *@$   "#$@(`"(@㿘`@!`< T "@  $ &` "&@&`"Y"@ W`H !   / 8`\  8`\2 @ T   ``"   T X \"  L `   ,`@  ? "  <3!&`D T`@`$ $ T- h!  P@ 0 "$  T   >  , > P@ 㿘   X `\`"  2 T? X```  $`$``<$`<`@$`@`H  .`H`J@ .`H"@6`J4`J ߀ "4`J`,`H`\` $`\,`I$`<< ` @Ad$```<`\@&`@`&`\&``\ `@@ `D&``$`D@`$@$`" &@$`` "`!:"@쀠 4 !<  $ "428㿘! <` 8` 4@"LL€   ؀ * "@ &  ) z l  T! H `? `!`  /`8 \ `8 \2 @`T    `2 `T  "  `T`X`\" `L  ``, @  `? "  &` \ ``@$`$`<3! $ DT @ $  $T 2` ! P@͒ 㿘@@` 8`4:`" 2 !  :  4  8< `24<А   4 & : 6  4`6 &  $@;q@<㿘`f  @`@ :  2 s `f   `@ :  2 d`H`\ _`\ `I [``" UR``?"``$`@$`$@""`\ `` &`\&`<=`@<` @?B`\&``` &`\&`<=j```@?&```@&`@ `H `J6`J.`H`p @F"2!d !d?&!d㿘! <` `8` `4@"L`}L`€   `؀ * "@ & ` ,`j$``$` T T@ `   \` `@ `㿘! <`  8`  4@"L <L €    ؀ * "@ `& `\ ” 2j  T $ T`H 2 `\4`@: @ @ T@"  @ <V!Ѐ` @ "`\B "`I`H "`I`@ ?@2 `I&`<`&`\&`&```I<3 .`I \ `$ \!<`f  &`D`@ :  2   n  #\ `"\, ",㿘! 2  ƀ 2   T T@" $   @"$  T  "2 \*" \ L@  "2 *" `  `I !3 ؔ!㿘 T T@!   `X`\" `L `X ` T  I 2`X "`T㿘 T !  <` `8` `4@"L`5L`€   `؀ * "@ `& ` "E  \ :A H @ `, H$ @`` @T$` / P`8 \2 @J`T F H B! T@ $$<3!$ D`T  @$` $`Tt )`P@\ 0$ ! X  {` "   X`` @ #`#`+`H#``+`I3`J`#`@ #`<۔ 㿘  X̐ F   X! `   # # + H# `+ I3 J``,`  <3(  T T "  <3`  "@   @   ``,@ <@a # D# @# <㿘 !X `  +  `X T` `@+`H+`I#`#`#``3`J <3`#`@#`<#` `"#@#`!""#`D T $ Tg ?㿐   X `А 2 װ ``X   @& & ` @C& (8.2  6<  6   $ 2` @ `  \" |@ & \& <@  & @; @@ &  *>`6 '<36`& @& <& &`K+< ($!&2 2`  `& 8 + 2   @8@8# &`/?#  2  , ( ?#* 8 $ *  p@&ᘚ6& D2  `22  `& @B &#@`#@` @A &@#@#@& ` <- * & c`( "`(㿘 ! X<V```  < &`&`$ , $ $$ $ ($  &"P  &! l 24 :1 8! :?쀢   ?4 : .`H.`I6`J&``!Ȑ&`<`&! &`@$ $h$!<VaĦ" 2 " !Հ  :&" " 8 *2  @ @7\@7#@ &!.!դ 0+< T)<3?#@  @2` @ ,@ ( @ @?#* 8 $ @BG ( . (`2 c` ?"`  L@(@!$ P, ?$ X$ \&``&&@&`!&"&`D T N$ TАc`" P@  @B&㿘 * 2 8<3!  & }~ 0  }ے 㿘 ) _! `X  2  `6  *@$   P$ ̒ 20E `X   @# # + H# `+ I3 J  ,   ,)<3 T T "   ,<3  " @   @      ,@ <@ a## <# DA 㿘 ) Y (4: S!` "1 ``, <@ <*  @"@ "  =` T@ $`$`<3!$ D`T  @$` $`T `t $`P@O 0 X   `X<3   @, H$ , I$ $ `4 J`!$ D$ @$ <㿘! D ! P"* ` , >$! $ D  @ <E<C<D ㈒`"!"!"""""!"!"!"!"!"!"" ""㿘` !``<0`<0! "<3}:" <3! !<3!!<3!" |ɒ@0<E!80B!h㿘! t " }! "!}!! }" 㿘"T " <$"P"@`2 !, ((0: "!,i   (* , (8 s  P@ 2 <c` ?"`    4 㿘 ( ! ?``   <V! ?@ <V <` <V`H <V€ & <<V ?!Ԁ@   `<V   <V! @   ` (  !6 & 6 ` | 㿘 ) !{  (  0  0@ :  !70 㿘 ) A! 0  0@ :     00<V!䀢 )"T " <&"P"@ ((0: "!,0  (* . (8  ſ P@  <c` ?"` 㿘<V,<V"0*`   " D ``@?מ,  $,㿘<Vb,<V? + 0  & D  D"`H" <V& L!& H  :  :  @ @?D"HH HH<VD<V"@,"0*"H@@"D@D H"@"L"H㿘 D H H H<V Da & H`  @?x㿘<<V"pT2`  m <", ^<#  0 0  @ :  2L w "H (!": ; <3a!<V ؐ" 1 <V!! (% "T " <$"P (, (`* 8   P@` ?% t ` 4 "@ <V + >#!r <V"P@@ bp bp"T2`  <bp"T2 2 @ ? @&"T㿘 ) ! 0  0@ :   ˔ 0g T  !!  _{ 0[` "L { L €  T T" " ? @@" ? `I *`I@`" ? @@ 2 `I ?$ , $ X$ \ 8`* @3r , L 8 : `*  $ d$ L4 h ?, j  , ?$ ` T@"  D  P"`*$ D$ Pf ڐ㿘<3! 1<"*@b0 0@ :  2R a4 "N a4-<V (  %@ 4; "$a8<V$a  & $ $@ @>9a<<$a<ۃa4  0@€ !,` "* , @ $ $a8"$a8@2  "㿘<V<3a!? `   :    $@"@` @ $  :   8 `ڠ?<V@y!㿘<3!<V!&  `   y 0"y* 㿘<bT  <"t. <#,2` @ *`22"  "" # "  㿘</ D @=| .`6``1<<V"\"\ <Vbt<#@ #, d``@ @ .` .`2  * " d"2 d`4` d`w bt<?@,* @62/+  .`2G6  ` @2 "  . " ( 2`   @29`D2 , c2  0`D 2  . "2 (  2 " 6  . "2 ( 26 26  &  "` "& p& `D @< `D @< 㿘</ D @<ĞQ ` p "`   "& p   D ` "`  <  "│ D @<㿘 ( :</ D @<$ $ < (!  (  < < * b "p< 2    @  b*  &  &  "`$"& $ D @<{㿘</ D @<[ $`3 D 2" $ $< "" & $2  *  @""  p  D ` "`   "& p   D ` "`  <  "ٍ│ D @<7< `( $ *`0 2   2   2   $   2㿘</   D @;t<bt, 4 <? ,* @`<"@ 2`` "` +  2  *     < < < ZY<"p  2`< * @#+ 2  <* b 2 2 2  2 ( "+"@ *2bp2 ✑* @" 2 2  2      2?4  D ( 2  `2z@D @;`㿐 ( !ΰ?  2ʰ?ꀦ(ǰ?@  <f?`  "`<А!`"    2? ""b  d     @`T``X` @;$@ } `L  `` @:p?͐  <bX` 5"` ( (!<?$!< $!8"@ $`€<bW0< @<c`  "`&P.)@0 ⷀ ""T"P@ 0㿘` 6`2``*`@1ڐ.6   d@ƀB* @ 2B8 6`` # H ( P`C @0<7*  7'     ''  2` `@' @0ڐ ' '`  ` B<VbX  '''' <c`(`4 "`4"`(` @0 <7*@   '7 ''7@0 ' '`  ` B<VbX  ''' <c`( "`(㿐`4   "`0`0" "b  `,   <V  @`T``@`` @8<V``, ."`,` Lآ ``\@1```^ `,`0@B* @ 2B8 4 `4`,,`0`` @7㿘 (   4  ?` X`  t` `` `(  L@ <<V"h"L@ 4< <`@@+"L<`&"LU  <$ `<$ 7 /|/y/z/xẖ ?#@2!|"7!|@*74 O{`$ Ox<  *  @$ Oz  * @$ |*@ * $ Oy ߐ * $ @4  $ ,$ 0`,$   "<V U  " <VŒ ־ <V"l$ $$ 4,  $ (<3a<V!,$ !  :  n @7 $a8 "$a8  < } <А"z<c` ?"L?&"L<c`  "`㿘  yƔ ̒@-# . (&& & $`  D& 0& @6 " & D" & P T" & T" & `. u&  " & "  "`& "`"p`  @6ў`( `@6ʞ! `  `!,` `#    `  $`<E (  <C 0 ,(>(?`  @ L P d D H T X \ `0h(j(k&!&! |&!&! !" &!"  `<D  `` `"D  (`0:&" &"  ` ` 8  $ 4 <\8 (< # 6"Z&"&"P6"X&"\&"&"&"&"&"`2  (`2` ``( ` ` `2    (`2 (`2` ` (?# (ŀ@(Ē H  <3` !  Ԑ  㿐"X"Z@42  "00 , "    !"L"X $"L4"X& <0& ,& d,& 4&"6`<" " 6`< w`:`4&a,* 4 @ <R!$ 8 & 4`4 l* @ <R! @8& l $ < (6!  (  < < * b "p< 2    @  b*  &  &  "`$"& $ p &  "` " & & p& &"`" ` "` `` &"`"€ 0  @5 㿐!` `- "' `< @  < (  $a8"@a<$a< $@ <ҹ<bX`  "` 㿐"p``ђ`   `\  `&`\ &` _`p<ǐ!&`&`  @`x@5* (  ``\7 H 0S ( =` @@ !` –  +`p 0  0@ :  "``` @ &`&` &`   `" &@&`" "`\ $`p @4 {Ґ 㿘 g  p <   \$@ "  $ \$ $ "$ ^`(% i   . !` @- $ `.  2`@  `@B* @ 2B8 *``"` `0 "`02 * `(. 2  @<(3  ⬑*   ` `4  2<  2 < 2 <  [Z <bp  2  ? <b)  * #(2  <* b 2   2  2   2  ( "+"@ * 2 p2 ✑* @ 2 2   2   2       2 2  34`$ <` 2 2 ` 2 *" $ @`, d$ L ( ", \ 0  0@ :   +$    `" $$ "  " p @3 zɐ  퀢  p 8 4P 0 p㿘<"p< 2  !</  @ @ @ b*`&  D @3 % $`"@ 2" $ $< "" & $2  *  @"" @ & @ "`$$@& $ D @3x<V < aD ' ( `?=""b T  X E . @`X``T` @3Y1$@ `X` <`` @3C''& <` @39 CpTX t  &"T"@6? <z`/` @3*  d X`'    <_"H aD < d e" f g#d#\3K#`& .& d 㿘`<@⬑.`2 @  * 4 ``   2<  2 < 2 <  ZX<bp @  2  ? <b* ( ".`2 @ <* b  2   2  2    2  ( "*"@0( 2 "p2 b* @ 2  2   2   2       2 2 C 2@ "` 2`㿘!" &!" !;<#$ d!, 4 :$ L$ H$ P4 h . ( 6"Z"<#$!, H&""D<V$!8"x$!4&! 㿘X! w <Va` @29 T ! @222 Ty T@    @?$ "`& T @ ` `` p  @22x@  ` @?$`"`$ @ ` `` p p  㿘 ` p "`   "& p   ` "`  <  ".━㿘</ D @1 I p &``"` "&`p&`  @1㿘.`2`@`<".`.6@2<2 < 2 < ][<*bp +`2 2 2  <b." 2@ <* b2 2  2   2 ( "*"@0(2p2 * @"2 2   2      20 㿘 < * </b| D @1  &  "`$$& $ @1#㿘!</ D @1  $`  D 2" $ $ "@& $ D @1㿘!</ D @0 t %.`2  2  t "  ( "   2   2     D 2  D @0ў㿘` "   ( ;`8` `  A"` " A V `4"<Wb+`  `@ 2" (@ "  `` " 2"`"&"P@㿘 @ @`!<V``x:` 4@@ H?"p``}`   `\ ( `&`\ &` 2?<ǐ!&`&`  @`x@0@ DH/`<Ra4j@2C @&` "&@&`""*@  t  "€`\  ``p "` @0% ?w?`   "` 㿘` `\` (` `&`\ &`` &` 㿘x㿘x /?2- ` 2` &` `6` 6` <VaH6` "aH@ " ```` `B` "* `0B86`  p?#' ?` ?Ӏ??`  @ <fa  "a<А# ?  `( "`?`d'`'`` 'e耢 v 2 '䀢`'b'`" b b Q? `  L@ b bb `@ `< 8 쀢 b'䀢 b')ܰ (L ? `{ `'X耢 'T' b <T <T `#\ ܔژ܀`` @/ 6㿘 . (  & . t@Ґ㿘 ( 2)?ꀦ$?@``  ````?π`& & d` <& d < z`` @.֞ 㿐@`=?Ӏ` '@@0x@ 2\)􀦀6`` &`` y ' &"&" 4 ` $ " Ix "㿘  ! @&  㿘8  !<;@ @, ? 㿘<;<    ? 2!?򀢠?8  ?& ? @ @,! ? 㿘`2 ?  ?Ӓ  㿘`2 ?  ?Ӓ  2 @0㿘!</ D @-p.`2 c`<V<V "\  "\c"\$cc<<V"\cL\#  * @  ;" 8    2    <V<"`cL"\ " @ * @ *2  2  2 8 D*2 $c+ <#L*` `"%6 ` 2` @"` ` @2` ``" `.  @2 ` `.  D .  ` `2`6  D @-c  @-] 㿘 < * </cL D @-5 &  "`$$& $ @-<㿘!</ D @- $` D 2" $ $<V "㼀& $"㼂 D @-㿘<L( `<?..`00`21` `t"``(")` ` 2"`  `2` ``2` ``2 ` ``@ $` ` `2`㿘@  *  `@  ; @ @ ` 4`` <V#<f! @<f!@<f!@ <f!@  <V<f<f<f<f"! "a22## ` <cp` F"`C   A! "  A V    b + (      A<W"- ` 2b `| "b`( b ``Ũb&bP@*`2`@@ @ C+  0@8* 2 㿘. ` u   " ,? @% @ &   @B* @ 2B8 *`2``6 <c6 @"     t ? 㿘  @"  ` t`?#'̨  ?``??#@?@  `  <fa  "a<А#P|  2հ? ' *`  7̰? `( Ȱ?` `'7`d'`*'`7`  'r谒  2   b''` ' `  Ф @ b bb` ` 2  " < @< < 8 쀢 b'؀  b'؀`<``  '̂`$`< @+D'̂` @+&̀ %̒ ؖ ̰ <L ? `{ 3`"`< 2 ̀ @+$`<X 'T''`7 `z' 7'<X!<X `#\ ̖̀`` @*  ɞ <c<`  "` @!s@20=  <;  P P l8, ?"0 D D  "<\<; ?"㿐@@9t "3\?$`` &`` t ' &"&"䀧` '@ 4 @4    @"$ " 't㿐8@u?ꀢ   . (<Vc& d& h& f"c <c?т z`` @*@"b"`@  d    @`T``X` @*!$@ /`L " d { 2  d`` @*? 2  X& d   X&  T<V& `. (#6 ##& < 㿘 . ( . t@㿘 @ @`!<``x:` 4@@ H?"p``w;`   `\ ( `&`\ &` 2?<ǐ!&`&`  @`x@) DH/`<Ra4j@2 @&` "&@&`""*@  t  "€`\ #<#<<V` `p`` # ?"` "` @)p ?pY?  $#<㿘`< #L*`  @, 4   2# t " ( "  2   2  2     2 `B p` ` -@   2# t "  ( "   2    2   2      2  ` p  "`2` 0  @(oΐ 㿘 <V`` .` 6`  \$@ "@ & & \  ( " ` (< \(` & \& ` "# L i   `n*  f< i 2 L @!\*  T< L @-X ` 4 @<V#<f! @<f!@<f!@ <f!@ P  <V<f<f<f<f"! "a22##  <<`"  @   pp <c<` p "` @(=2 o& 㿘 <V# <f! @,`<f!.`2` ,`<f!.2` ,`<f!@,`,2`2  <V<f<f<f<f"! "a22##2 @0Z㿘X "# 0,+6 .`6    ^.`.`.@.`.`& J@ t6 J` r 6   .@.`.`.`.`.`.`6    ^.`.@.`.`.`o@T` ?㿘  ` X\?@, ` 2$  2  X<W  @, $ TH  " <W! <W 2 <W $ T  7$ 02  P @,    ̐ `   @,  o @  h ̀`"  ̐ @,  o @ ` ̀ <W h<W H$ T  ހ  T  $ 0 㿘`(  `p H    `@`p @'?n(㿐   X` ` @` " " D <X!``  @   `0< `4  ހ   <w]#  `h#\#` @(㿐 И    @<bX`(  "`(`` @&۞㿘    0  0<w#o h˖  o`@Q 㿐`( `<w#`p @&o mk  `'@ Ŗ </^  D @&{<W Ȓ  ><3 ᘒ ހ`$ ᘒ ڀ`$    , `o@  , @&j D   АD @&\!  @&VD    D`p @&FDm/D @&< 㿐 2 8 2 8P `  ''<W Ȓ & 8 8@ 㿘P\'L` m'To Z* l  bZ  ?@& &&o*  \ @ &\&<^  l!(6t &h`"`.`ക2\X `" ̐(77 77  7 7o 7 / / o @[oT @U ` o@Noo@oL@D &wU㿘 @ 㿈 `` R`X`o ` M `P J p g F E  ` A*2 ```(6@@ / p@ ` ( p@ $ p`?* 2   @`o  @ ?  8<   p5 "``􀢠$`  p@! "`h  p D <X!` `h#`#\ ( ڂ p -<W    (P2Q <Ȕ ‚ p<X ,`  g `@ "` " ` D `,@ ` 0` H @`  ,`h#\#` ( , @$͞ p   3{ p KL@2E @<X `  0  Ȓ~ 1ȒH , @$2    2    `h g `h `@ `h#\#` `(2 p07Ȓ &<3   H" ``? 2  g      , @$S  p    p @$Ek. 㿐` ``3'`( ??ꀦ` `  `tI`  q? <W Ȕ  g?e `2`<X "`]  "0W U?``$` `2`  ט E`` ` @#`:?``X@5?</?ɂ D @#ȞU<W ȔL  D`    `   , @# D   'D @#   ހ2 㿐 </'?`D @# <W Ȓ D`o @# `X 46 @@  Ր&  , @#~    D D @#o㿐   ' (? <W ȔwX2V?ꀦ`2`<X" O  J"0H?`</  " =`` ` @#9`</0?? D @#<W Ȓ~  D`    Ԙ `, @#  D`  z D @#P"!T  8!U!S?0?T@ !! `2<v?<;@ @!U D D b? ]?Ҁ ``` U?ꀊ` ?'QO䀢 "r䤒 D? X7Ѐ ?X@5" !T!T"-?"!T "8!U!S0 0 K <@@  D  D 2?`<Ѻ`'H'P @<ђ` @K<W`Ȱ  @"?̴ <Wa.@Z@  P X2 o@ @ P7<#  P 7<  : @ 2  ( @   ( (   o& @ - X@bp@<Ѥ<@@ @@ @D@2 $<W<W" . "1/<-<  X @p @Ě<<Ѡ ` @ @@ P @ @ 2 ̑.<WȂ` @!%@H"@#P4 & 㿘<W |<f  0  *@` $  -*@ 0 ` 1*@`? 0*@*`J-<ѐ <3,*`0" (","0"00  "0  * <W`(<@#p"@ 4" 4㿘2   @`@, @2 B8 6`? @ގ&  x<W#L ``(' [ 6 & `  $b  X  '' `   x ޘ @  <W* #`@ *`     ` "  P    `* `@d   @ <b#\c}䀠`` @ 0 g (  '`2`L<V!$` <p!@0 @? @.`<Wc`*   R `` ` *  `*` *  R ``  :  L`  * ` R "     ` > zĐ m'`//7''<WL  "b '`'`` @ <Đ P``*`  `` `  " P   `* `@ " @4"@Ȑ"    " \ ''L @<b#\c`` @㿘<cp` "` ?    "<4 #<V1 "`<V!$`2)  #< !h  p   U*` Z6 !$`2  < !  o   E<W#H`2 @  2  6<` `! ` ` o `0-< b|,@ #<V` ``4 k  `L,@ @  2 㿘<cp` "`       `  `  P<W#@`   ?''/8 <cp` %"`qT@~a* $, , @,#  ''@  ' ''/'/ؐ㿘` 6`(2<X `2<8 *< &$`L@   2 `X  2<V!$`  <`X"o㿘<#p .` (6```K"#p @* @ 2B8 *``>p 9`L @<W#D`.p 2%p+ <W `* @ # **` * 2 p @j2  eS p` "` 0  t D $ 㿘 0-  @p 0<`ؐ "`؁㿘 T C P  < P "@Y <Xa 8@<W`& L&n & Ð <ј"p ' @$  P @ 㿘@   #< @0 O 0` ? $`@% X"  <WX   @ 2    " "  㿘@  5-<f`1+< ` "(`2# `  "@%@ '    2 0`ؐ?%``2 `&@@ #    2 Ғ 0<  " m㿘` 2` 0<`  0<`? 0<`ذ??K"`ؒ  .`  '   2 ` @( ` `   `@Ӑ `@Ԓ` .`@ 2 ` 2@`@&@"@<f!@ " !  2   2 㿘 2` 2 `S 0<`ذ?ɐ?"`?  &` .` }㿘l      2 @  " "  x<;@     ؐ@'   "/f?@Y : 2-@m?ݐ"`-<e#*` € @Ɛ &4@T@ !! `"@?0T@ !! `2@0? +?~ la `? :-@   @  2  ?"aa2??ݐ"`<e#p*` € $` $` $` $`` ԰?π Ҁ` ̀Wpư`?   0    8  ?   2  `? @  `  & $ $ `$ $  P . ?@  @ 0   @  8 @ ?  `,  " ?*@ $  P     2 $ ?, $ V `@Q `$$  ` E?@  @ 0   @  8 @ ?   `$ %`8 `@" ?ꀢ  ` $   8  2  ` " , X}<<@@”   ? x`    - +?%;`#% @`ؒ "@@@ؔؐ 7 '<@ @   ܲ`  ڰ  M  4`"E @ =" "  0<mp ", <X "# (" (2 (D ܀`",2  42" (퀢` ( 2  <f@@ @$@@ ""@<f@ @@`  `?㿘 F` C<e#*` € <jʐ"x7&3<m`0   ? & & & . . & ` @ @ c0@ P0T CV0    @۔  2 㿘<X $<map`?<X""a8 #<V 2" <(2f   $`؁㿘 T`<X!<X͞!8C 㿘  #  6<XaX@#<X "l"Ą##t  $ ܖ  @ " "@ "@ `, <&"p 4#?&"p&"l&"&"�&#&"&"&#<&#_ &x0&`4㿘 4 & 4sj   ° ° ° ° ° , , , ° ° ° ° ° ° ” ” ” ” ” ” ” ” ” ° ° ° ° ° ° ° ° ° ° ° ° ° ° ° ° ° ° ° ° ° ° ° ” ” ° ° ° ° ° ° ° ° ° ° ¨ ¨ ° ° ¨ ¨ ° ° ° ° ° ° ° ° ° ° ° ° ° @ @ @ ° ° ° ° ° ° ° ° ° ° T T T ° ° ° ° ° ° ° ° ° ° ° ° ° ° ° ° ° ° ° ° ° ° ° ° ° ° ° ° ° ¨ ¨㿘 0 @ސ  ,`"   y 2 @  D<R!4. y   @H`m2 @    @?$ "`$ @ ` `-`  p @_מP<R!4H`l2j @  ` @?$`"`$@ @ ` `,`  p @_P<R!4H`l@2? @@   ?$"`$""",@ p @_y 0 @ : @ :  2>6"X P  P@ :  226"X</ D @U`  "` " &?" @X P@" " < <`` @F[ 0 0 @>\ #㿘 ` 4 ?Ӂ㿘 ` 8 ?Ӂ㿘  24  `T€ " *? 6 *`L€!</ D @m  D & &"`" ` "`   &&  D @۞ 㿘   V a? `($: `Y?" `8 `( O4bZ` ,`(`14bX``T€ "`,`(??!</4`* D @@  D`$`$@"`"`` "```` &"` D @0`p 22 ,`)`< z`` @z`L@b@ " 㿘V  <! D`<f?a\  "a\<Ґ g D`€&  Z  "?V "``0""T0`<"` ,b,b<Y!4<Vb(& `y<Yax,`z,b<V#&  @ !! ```b <Y!x<V,`.,b4`c0`& ,b\ 4`,,bc$c,`)$` H< #$b$c$b<V ܔ `$b,b,b$b($b4`* L@!</ D @ɞV@  D`$`$@"`"`` "```` &"` D @Ğ` (` @ " 0 Yz ?Yv?Yr?Ձ㿘  %  &"@@ x   2&  *` *  * `2& #&  $" € 㿘   D ( 2?ꀢ(|?  v?@a``  g?π& & d& d`a@* 2  2T?А* 2 #8 T$ !! `2 @?.` T2`€ " 6?. ) 6 *& 6 L@!</ D @  D & &"`" ` "` `` &"` D @ <`` @& < 㿘 ސ " ?    ?Ӂ㿐 8''H`<9#D@h` ?'#$#D ! RS! ( " (   "P !H`#D@uh` `2"`$#D㿘  `??ꀢ`2 ( * !: & ) N"P J{? `u?G " n?, )  6 c& (  $ ( Q? (  (   S  A>& (`"< "P "8 ) /  ( * 0 @!,  (*`, (8   P@`<c` ?"`  @YZ, ) &"P z@ 㿘?  5` @@"1  +?Ӓ€ #"P8"8&`"$ (  P  P (  ? &@  z@  "8}"&`$z   2@ ( (:2 ?2`  "` " d *"`2` " 㿐 @  '?  @`?j ? `@@ &`㿘   `@!? I ?  <`2"P?Ӏ "Pz 9  ? `<㿘` ` "?" ?  (  & ( * !:2 ? 4 `0€"@ 㿘` `  㿘?ݐ"@`p <j"*` €<;   ? q`  d@T@ !! `2# [?# X <; R? &0M" 2<H?; "@1    29?8@B3.1<Y!0 !0<ߐ 8!0€Ւ??ݐ"@   $ =i2 0f2 02 @0 Ȩ 㿐8  4 , {?`X 2  Z`` @>n? Y / 2 `` @.^?$`( Z``  ` `\ `  $`$`\$`<qYG $` <* @ *@ $ , , $ 4   X<V, H 4 4 $  "H  , , , , ``\ `  $`\$`<qPY   ,$ , 4 @ א*  2`B@8 4 `(D@㿘. $  <3!@  h   b  "N &N $ 'u@e#<3a & . $N 0  &N $`. &ut@O#<3a & . $M  . %㿘8 @ 2  N $ ". &N . $. &. % 2 㿘`.`` * <3!'`@ & #   .8 3<3 2# "  N $  . & a" $N $N . $N $ 2 u@a @`& . $M   ـ㿘 .`6` `2  @ * @ 2B8 *``& p`$  ?`<p#<*` €   p ( l` p v  p,@h2`  p @2 Xܐ 㿐  oi 㿐ܖ  oi 㿘N ' " . '  8 @'</ D @*N $ M . $ @N %  <3!@  = 㿘N ' 2  . '  8 @ </ D @fN $ tN@) d<3a & . $Lِ  @e㿘 P ( ``2 ``  %"`  0!`2`<q!  "" "*&"*$" ""*%*'  "&  P`k㿘     2  ? $  "@S P`Ot (   2 ?㿘  89  8Β`㿘8` ]  㿘  & C (  2 㿐   @ "     `` ` @ 2 4 &  㿘@< 8  l?+<bL#<L :  :  bLPbP0 @z`  3? T  "Ģ ?А @ r 2 ` !bL   $  `?<Y#d bL`@ "Đ $@$`%"Đ  bL @J`<"PN #`S 㿘"Ā /" @@2& `@2!``"   2 ? $  "?  "@Sɔ   2 ?ρ㿘"&"'   S "Ā 2㿐<Ҩ`@֐<map`= -<` "5`(  <3!@ <<!8<Қ!@`4@@H@`t  '<3%< @ ` L $L % @#\@  @4 %  2 `(`2`%@&&@ & 㿘<X `$ђ``$N㿘\ ?<;@  @ ?  ?<X!  2 ݐ 㿘<b €<b@  ?㿘:  *&: &@<<Ӕ`@%`X  <"   * @&  p @T<b  ' Ѐ   ր   0p?<@8@  @/<b  ' Ѐ  ְ p ?/''쀤 i/<b  Ѐ  <b  ?͐ K<Xր 2X?  @'@`02  `8  (F 0D 1<X `" 4 , 2:? 4"' Ѐ  <b  ?͐ $ ր   `2'@@אВ'@ 8 ̀` ` ,  ? n '@\ ""a Za  WT@ !! `2<J?;@ p@ Ŕ T  T ;?pP`Ȓ@ '"! d <"<" ?   <"<" ? @ 䀢 p?H'L@< @9 0`<<"", ,7'/7''  //퀦`  / L /''  4 '  ؟@ 0 ؟@ 㿘    `     <^ 0:    P 1    ?@#  @  P          {4@  u 㿘      @`2 P     ] ` 2`<] 0H  "   "  "  " 2      1     (               @k 㿘 @_ B `㿘``"0-3?0` ` @ܒ 0n#? 㿘!`<t#0*` €  ?0  0 0  㿘  ? & `"  "` `"<f"@<fa`"a`Q<f`"? 20 0     2 ?㿘`"  @@"  ` `"@<@   @@V    p`B "   8N?@ 2I?\P D?`P ; <.@m ` `''쀢/ /<b   <b  ?Ͱ .<& 0 ?/ 2 ?`P  ?.& 㿘<[ !ē*`@ `   Dڒ  ?ɒ D@  $`$`, $` ` "`$```"%`@?``  4``  ې?* #  ?"  $```@B ` ?` `0 $ ```@@1  !$ * `"  ` ?` ?` 3 ?  2? ,[`< $`0? `   ` <f   @``@Y  <fR` n?<f!` R ,`,2J` @2E` @2@` @2;`  @26`( (@21`$ $@2,`   ?2&! 0   @?@?  @ ? ??   2 2 , `" `` &`` $`$@`$`"` ` ?ꀤ`& 㿘<[!ē* '` 2# &`0` ` 2 `` @2  <[!P?㿘  @0㿈@ܒ  0@ِ `2? 4 )  $   (2?р "߰?8 @  @ 2Ұ?ꀢ    2  ` " "!   6`&@&` &` 6`6`$6` 6` ..&W @ ?' 8 8& 4"  ..  .. D"7 <;   @    "/?@ : 2.@Z& `4`& `` :.@```@Ò 2@``d?&      "& 4 "  "."! "L  4 " 2B?ꀢ 2 4 . 4 ! 7 Ӓ  2&1?  22 4 @  22`2 H" 4   `  22  2 L" 4!   ?22`2 P"   ?<f`- ``"", 0 2   2  " <,2  " ׀ <[,* @2 " `" x0<Ӏ!h<ӄ!(#h@#t #d$#l#p#\#`@, <Ә #da#\#`#h#l#p @  " @R@ /`㿘k  㿘    < @L `  & &  & &   *  & %  @4*``&  "?*@ `& .` *`" * &$  & "$㿘 B    @" 4@2  2  2    *  @  .  `@   ז    . .  &.6 "  @" * 2  㿘#</`D!<W Ȥ @ 0  @nc  @x``, ` @p `  d֐   <["\@  2 & 6  <["\@ $ && 㿐 $ S  ??''@'<[ " 8 2 .  2 .&`` `   @2 2  @ ( @`?p &$\ &$\㿐` $` `*``2 Ȑ 2Ӱ?ɀ`  @q `  ư?ؖ ` " 42  2  2 ` ` * @@   * "  "  2d "a    @   "Q     8 "E 2A  @ 2;?"d'!"3 % 2"      `@D "  2   (2 ?d,'?' (  $@k &. ` .&&$` $`%  \?`?$`T? W㿐`  $*  "?`  @    x?  " 42  2  2     * @@@c "@ @ ) T ! ``"` 2``"`  2`` 2 = "  " & $  ِ?r ?&    ,  , ʐ?<fad  "ad ?㿘 <f"!d0  ? % *    `"  2` " $@3@@ 2 `ߨ"$԰㿘  `/ `` &`  6@ "    `   `` 2 @`2`  P  , 8 D<p \((D`㿘`     @ _`"  `2  `    @ `"  2    &@m@֐ @  `"y    &@c2p   .`?  `` `2\   @.`? @ O. 2L . 2E  "A  ` @  73  24 3   `  ` ?:  `?/ 2   `?@ 3  `  ` ?:  `?/`2   `?@    !`<~(<"@<"H<"P< "X< "h<"p<"x<Ӑ"h'H <Uj"@!<<Р"Ub@`2 <"UZ" /    0 0  /` 4  2#\2 4`0H<#`#d#h#l#p#t#x#|###"2 U2 ` ``  #<@U)c  ` ``<Ӏ`#<#(<Ӓ#0 U\ J (J 㿘<f!| @U 2 㿘N <) bH@F <! b@@> < bP@6 <?bh@. <  @&bx   &@ 㿘.` <T#8 `#<cPT"`  `<Ӑ#XTp? *  <*@ #'H77/   `\`2N g) 8<+#``5         *   @ `  @\2$ f <Ӑ#xTYH#\#`   ߚ       \&`\"``\  7 7 /瀦``7`` 7 7\`2H/`<[bl@h`  'ܮ J*`*2 2`@  /`H#\ 1\ 1 P@  @ B  H:@ `B :  H#`#\`  6 7 @  .  `"   '   '  8 H 6/` <`$/`@  \` <S# ?  ݔ: "  < " ( <  8@ "`$ <. @  ( 8 Ĕ! @/`` `(`$ " \ 0 `B ;@8@  @ B :` \`2 H/`<[bl@h`  ܀   \2Đ㿘   !<3  H@*` 8   㿘 & <`8`?"` 2< 㿘 282< `"`<`?"``<`"8` "`8 &`8@@ H[  " 828 8`<``"`   `<"`8 "  282`<  "8 8 "`8"8㿘 `2<`" `?"`  8 &  "88 288 2 < `"8`?"`8 8"8 㿘   @@2w `@2r `@2m ` @2h `  ?@2a `@2\ `@2W "`"@2R `@2M `@2H ` @2C $`$@2>L & &N`&@`&` JJ@ ` JJ@ ``) )@ 2 <`<2 @`@@2 ?"` 8$`8& q  8 2  㿘!<f!|@U !| " @L 2  2  "    B  @$  㿘!<3 *  r  <O#@  *`& & &  &   : 8: 0" " $   㿘 <f !| ` @ "   @   $   "  㿘  ? J   2  ?@2   ?#@<3  7     <3- <3`  *   H !  8@ 8b @ 2$ <O $ <<f!|@  @ @ `  &@ `  H@*`L &`  4 $ 8㿈H/`<["l@h`?` d<~ ܓ*` € \  "W  R ېO'􀦠 K  "F  A >'$bl H< ِ 7 H/`bl@Xh` А`< > @ @ 7 <3 `<!*` + <3 <<*ሐ"    @ `?  ,#\   `'<~ *` €'  5  6 = >  <'H/`bl@ h` t*'􀦠T `He  m  ސ` @K'􀦠P `DK  S  Đ V'􀦠T `H2  :  ` ~@Py'􀦠Pu `D "o   j  e'w0^[ ` U  2@N GK'􀦠 G HD'􀦠 @ ='􀦠9 ` ܐ "3  . <f!|"   "     'ܒ   6?  '  |  -' '$bl H    <3 *`@   P?`@ E E @  @<<Ӱ#N&` #\&<Ӑ"p#`$#d#h#l #p6#t7#x"#|##########@㿘<fa|    H`<["l@h`a|`,` 2 8!`` `2`0 <3  H@ *` 8 ` `2`` %bl-$&@㿈'H   H`<["l@h`<fa| ;<3`  *      @ 8` @    @  >  <ԒP#\;`@b@@$    ɶ&bl%@&H"㿐<3 <a*@ (<3 <*b @ <! <f@ `? |#\@㿐 *  @`\ " <3 `<!*` (<3 <*b <f@ <!|!  @` `? #\㿐<3 <a*@ (<3 <*b @ <! <fa|@ `? @#\) )**,X,X-d,-@`l<MҐ Ȱ <@  4<* * @   /<'''̒`@ꦐ'<"!< Ĕ؀ !<M  P  6 Pr  ",NF `CT`? 㿘`\<[  \@ " `\  c@#  p @|De  \㿘!P`  A!P@ & \!@&< <.!@ <* b* # * # * * %* 6 X& T6 P& _& @TB & 8  " ,M _<g "#T_ 㿘  <gb  <gb *  @?ϑ. <f* a  " `* $$ @QӒ?B  <[?<g""cTR`""  2 ?  ‑* @   * @"%" 㿘!</ D @H P & <? & @@<gb ! D <g +@ @@ `   +  < 4& < @ $& @℔  D @㿘 <g 2` ?*  $ @8Ɛ @ 2 $@ 2$ $ 6<[ (<R!4"H`l2 @@    ?$ "`$""", p @LC5 0Ԑ 㿘 <g 0?b(@""@22`?<g∅( "   2   2  㿘 p  p @C ("`$ ("`<#ܒ $ $ <$ $ $ 㿘</ D @ܞi8&  $<[# & $"# @ (<R!4H`l2q @@    ?$ "`$""", @K 0ځ㿘 <V @ , `* ܰ?ꀦ CJ B$  ̰?2*   \? |` $ \$ <AȒ   $ $  @ ,`,` <[ #,`  @*  " `  72 \  $ \$ <\A$  @  *`  ,`  (   @9$ (  \    $ \$ <ܐAr ,`..   ^2  $ ,`@`@  x@ : `4 H?bp``H`    \   $ \ $  2?<ǐ!$ $ `@ x@`DH/`<Ra4j@2 @$  "$$ ""*@  `t  b€ \ ]  p<K+  p @ӞA㿘 22 4!<[# 1p  +<c6   ` &  `& $x& #<3a $# 6& <V#,` .`2`  6 4p 4 $ p @&?Ay"?ɔ (& 4H/`<Ra4j@2! @& "&&""*@  㿘`< 8 </M? D @@@$`  , @D2? `  $ $ $`a4  $ 9   $ $@` $ `$ `J4  @  @?㿘<Vc,<X"!"c,@H`<V#, 8?8`<!P*` €"` 2?   ?2?<;   ? 2?`2?<V, 2?<X"!<",   ?А ؔ ۰ذ?<; @&    Ȱ?耣`İ?逦`v<g+` <f ‑* a*  Դ ꀢ   ?0?1<[# 6?&#  2`?&#? 2 `?P 2`?π "? @ 2?ж  N'& @|</ D @<&6 &&& .&&& &`4&$`8&$<g "."@ $"#" @+M [[а0E<C?<; @ <  < 23?.<;   ?  ? @ <[6"#<;   ?  ?<[ @ @!<["#"?ց㿐<V#, H?```A?<;<    ? 0?򀢠8  (?ꀢ ?&  ?``А# '<[<[##'􀢠  < @  ? h"a@aဦ@6=0w<;  Ȑ@    2g?<g"Ȁ <g_?b+  <f *@ *! S  ' ' ''< 8 = <;  @”    2?<g 2 2` ?* "$?22H'D'L'< @  ? 2?ρ㿘Z <g"  )</ِb  Z <g" D @۞h, @   L 2 D @ߞ ? D㿘`<g"<f  a#<g b,@ @ `( 㿘  \? |` & \& <4=  <*@ $  `@,   <V *  , , $$ $ 4 H ^4 4 `a H & & 㿐.<f* a`  `. $` \`2` $` \ \`  #`  \`#`0ր   ` `z6`$ ˤ     `$z+  \`   `  @<V``D` ="`DZ  |"@ @ f    @ :  2  >Đ' p p  @ :  ># ' @'`2 ``r` @0l $` \` $``(`` @? "(  !* , 2 @4 `  @ 6ט  `  @7  ` %``   6 4 @  p@!=t`\  " @`\\ " `: *`:\ @ (D@ 0 AD<g @ 6?<g<fဘ + "`2` @ (?#㿘`H<f &`H`  \*`D @ * &`D!  .? ( l`T`L &`L K<[#`F<[#`<3`P `<`8" !,6ᘓ*&`82` -   "  \ @" `@`<? `P @    `<?6 `?  p @< 㿘 ( `L :`I 2  5 "  | " M `2  <V#, " @   `$   <ޒ | ,?ɰ5 ?#@*`2`?A   p||  p @2 < 㿘<[#`# .`2 `@ p   1<g# < 8    (  p @g1?`< ch*  $b$bJ 㿐@  `?`0 @& 7& 6V 0 4 2 '` @ 2  0 @О?ꀠ``0 @Ǟ&& " "   2  㿐 "` "ɰ?XZ@ 0 @t 2?( ?À<\09  ""`>      3  ??~'|'?' (`w`?'t`q`( m`?`h'`f$$`< $" 2$ R$  0 @4, (d`0$"dh $"hl$"l&`@'6b`.`(`&bd&bh&bl` @&b`"X@ "@&bXD 6XH/`<Ra4j@2 @$` "$@$`""*@  €0 @ ?` `p @`6ِ`0 @ߞ㿘  `0@~ 0 @︞#" `""d#d""h#h""l`#l +(* ( &&@ 㿘  ` @@"q?V m? ( Dg?<R?!4cH`m2S @  ` ?$`"`$@$$ $ - 2  <;?/"8 հ>03$2X "@ p @e6N0Z*  2` 4X<\ - ! p @N 67 &@&``8&"& 8F%b 㿘 ` ?b 2   6@.` &  &b@幒` 㿘`8<&  &`&`8 @? .``@A@ < 㿀@@ 쀢 :1㿘 @? < , `@@ ? < &`&`8& 㿐`  `@??#@"`?ꀢ` ۔ 6 l  ڰ?l?؀ ' " " ` 2`` @2 `,@> `$`< `$`0? !0<3 *``\` $`\$`<Đ4`7'0  !0<3 j2<  `pt 0 @f$?'`k D` _?'  ` `ND<\ `  '<\` @A?-t ΂0 7? 2  @:`H`<Ra4j@2 @$`   $ $`$@$ "*@€ 0 @>'0 @`p @4ې㿐 @    ``2ð??#@"`?ꀢ " ( ??Ӏ 2?ǀ }l&2  : ?@4o /` @1 2 "0 "@@   ,@7 `$ < 0? !0<3 *  \@  $ \$ <ؐ3`60  !0<3 j2? ` p @k 4T "G?0E `t  p଀ `D @U 4> 1`@-? "ؔ '?H/`<Ra4j@2 @$  "$$ ""*@ b €&]l㿘 D D@" ` " ", 8"*@"㿐 @c?&`6~ Z<\ +Y !@ &` b "  \  &` `@y`  \:0` &`0? !0<3 *` 78'0  !0<3 j2   ,' 0'  4 '  8   ' 8 "'96' '6㿐 @ @`@ @'  '?ꀏ`?0@n["Pz >a2'&`" @sQ D<R!4H`l2G @@   ?$"`$&& & , ' ΂"P   @"# 2İ?  @( ` ,@ ` &` b "   &` `@⡒`   \0? !0<3* 4C`0  !0<3 j2 `"" ,H/`l2 & `@`$`&& "$@, "T?S' 0&'  4 `"'  \ "@ & \&  8  \  p @멞2 2 )0% 8 8+' H/`l2 & `@`$`&& "$@,  @]z㿘 ``$  @ "€6 "`  ``* ` ` 4 "€ 0"@  @ s@2-? P P l<;88, ?"0 (  D D" 2\<; ?"0?㿘``8`"bPZbP`` `  `D`D@2 Ab` `( " `P`P `l@ : "'4!㿘 t  8)8 ! P` P` l:`" '"$ 㿈<ըb0@ץ  -<h,@ "W+<զ 0 0"`@":bp   #\"耢  (   #`"耢 "#d  #d  @o "` ,@" `@`@ "`! @?,@"?   ,@   % h '%@&&@ & 2 0Y2 @0,2 02 02 @02 02 @02 0h(Ӑ@(֐@2 0(ً@(@2 02 02 0k(@   ``"`<b#d"b"#d   ``"`<b#d"b"#d㿈<\` F  <$ด#h <\*` "`#" 2#"`a*`<#h *`@ `<\"耢 "   "  "@(  " 2 #"  2""ഒa*`?"o$`` " ` D D@ `QP!<\8 "1<+ <\@  ``` ` ` `     "  2" 2#" ഔ2@<$" `t 22b 2 "b$ 28 ` `?  ?`$`<#h'' *` \`" 2U  D D@ " `L J<R!4 8 =H`k@2o @` `?"`""""`"+@H/`k@2S @"`'""'"+@ 28 2"a*`<R!4H`l2- 耢@   ?'"`'""", p @n/W 0$ก2 @02 @02 0 "c<g*` "  㿘"c<g* c  </ D@2  @& $@ @40  㿘  ?* 2  &?Ԁ`<\?Ր!l&   *͔  .,"c$# ?㿘` <h "c* ` " D T @-<h :  :  (0"   @" @@ "$""@ <R!4, tH`l2 @@  ` ?$`"`$@""", p @簞. 0<R!4H`l@2 @@   ?$"`$""",@ p @灞.j 0" :  :  "" $ !0 $"&` @ :  :  < P  P@ :  <7#00* 㿘 <g"x`"t cc* @`0btt2` 4"tt?`2btԐ  㿘@  ` T@ !! `2"t-?"t` ` "`$? !$"x ` $"x "c<g#*` `  bt  ?` `2bt$"t`$"x 㿘@  "!"| "`?ꀢ T@ !! `2` ?`"|`t "x   2@ ""|"`""t"`"x"` 㿐"c-<g`\''- @ <R!4#<9"t2 " @|" ``"&`@&`&` "€İ 8H`cD@Qh`@ "'"@$cD ! @ @ 4  @ :  I @O`p @J?-3?"!H/`cD@h`  ` 2"`$cD  @ w`p @i>,e>7<! D!H/`cD@h`  ` 2"`$cD ``@&`&` `x@ǞH`m@2 @&` &&`&@&"@-@"€ @庞0 2"t`p @属?,?Á㿘"c   <h` *` @僞<g*`#  `p<R!4 7" "t" "x""$"P@  @a``p :  :  , @I`2""$"P@Z  ``"$`@$`$` "€ "c@  @ @ 4  @ :  42?``"<ǟ@<ǐ!$`$` `x@ DH`m2 $``` "`$@$`"`"-"`\€ " "$"P@ @ j `<h  @`8``8` `<h #A #` `p @՞+ @˞+㿘"c<g#*` " "t"  "x" "$"P@ 㿘`@` r??#@2m?` ""| "c?ꀤ`T@ !! `2"tQ?""t 1 '  2"t@?ɒ& 8"x ,& < & @@& D  \T & H & \& <*`,   p @I2?+2?`  @% ` @㿐 ` `@H?Ӑ- 2&`@ \6 ` &` & `.| @ ' 2 8 " D"&` ,' 0'  4.E' ⌀ "@@`4`2:`: @@6 "㿘     6  `  &"l㿘   p @㸞*e㿐/` '  2"y?ɐ€ &' DH/`<Ra4j@2 @$` "$@$`""*@ "€N  8```\ `  $`\$`<D)    4 $4  $ $  @ DH/`<Ra4j@2J @$` "$@$`""*@ "`\€ @t&"" @. 㿘 $   ;?Ʉ @ @S $$ $ $ `p @$"c<gc* @  `8"t"" 2"t 2"<?À &"F  0" @?㿘 $@  ? )c  &``\ $ 8 $``$`\ $`<( $  $4 $$ $ 4 $  @@R  8  @㿘Ւ  <h". `"@  ?Ɂ㿘<h . "㿘<h .   `,@ǒ 0  ?  ?㿈<ըch@h  -<g,`@ ">`+<դ @ @ "c`"t P"x"` P :` "`: `#\#`":`#d#h c@3 ,   % `` '%&&@ & 㿘<\!R!<Ւ #[ <b" 02 0F2 @0q2 @072 0逐2 @0s2 @0tt8㿘 g , s   $ \" |" @ & \& < @'`X 4@@Ӑ  t@4 @` ` x:`4@@ H?p``.`    \ (  & \ &  2?<ǐ!& &  x@DH/`<Ra4j@2e @&  "&& ""*@ t  € \   p @' 㿘` @?  `"r?`  l?"```0*` 2`Z`?`T [?<R" @ཞ`Z ` #  E?`Z   ?@$ $ $ ` "  `Z"$ `Z" $   \  $ \$ <D&ؒ`)34 t$ \ $ l`P  ?΂ @2= p @'t @㿘 g ,   6 ,& `X4  t4  g, `4, $ `؀€ 8, ` $` " g  $ \" |" @ & \& < &0     \" @"& \& @@ x 4@ :  H?p``-`    \ (  & \ &  2?<ǐ!& &  x@DH/`<Ra4j@2I @&  "&& ""*@ t  € \   p @&ː 㿐`@?  2`t    8? / 2T x? "`Z`T<Rn?؂" @ߖ`Z` ` @ # Wb`Z `   $ $ $ ` ?'` T ` $ \$ + p  \  $ \$ < %`''4 t$ \$ l` p?'`P` b @Y10 p @Qb&:b @G㿘 P  P@ :  <3 @  @@ :  <3!0!c"&"ԁ㿘  l<\!#"tJ` . "t* @\"@&   D<R!4, t$" @H`l2A @@    ?& "`&""", p @۞%Đ 0 @ :  :  <3 P  P@ :   <3!<`d$"$"ܐ"$$"0!w 㿘"tJ` ""t. "t* "t6 2"t"`` "t`4" `P 2&"P"@0" .P"t"t *` 㿈 ?` @.x/ ? 㿘  @ "`?ꀢ " `.r 2`?퀢" 㿘T@ !! `2 M?* 2  `  C?Ԣ &     ":?, .<\V "` & <\!& $ |  $$"t@U  "t<4 ,, )4 b"V 2"t"t<""`"t`" "t2-"t"t* <\!"Ȓ  ?Ɂ㿐V     &`@'n "% \$`` &``&& ' $b $b@  `@d , "' \'(㿘 ?Ӑ 6@bt-`  @"` `@  & 㿘 ?Ӑ 6@t`&`6`t-  ` X6` oh.` @$ o .` 6` & 㿘` `00``5 0 `5A 0222㿘`` 4@2@֔@`2`㿘)<"L#<L :  :  "LfbP0 @#@-H? E"L` o@@? {  9?bt   ` @@2 `@2  @ 2  `{$ "L 2 `4` @`$``*2@Ӕ4` $`bt$@bt p# "L @<"PL #㿘"t  *  @@2! `@2  @ϒ` 2 ? & $,  >?|!   2 ?ρ㿘"t"t"`,  &?|  "t  2㿈a& 4$?ր ?<; @     ?,?ց㿘<\! E` "t`"&4: `27 4 @2 N   `,/.  2$"P"@`2 ?& &  `?  @2   "  N  2 +.  `˔  ` 㿘?ݐ"@`Y < *` €<;   ? O`  d@T@ !! `2"9?"6 <; 0?&0+ 2<&?; ?@W    " 0?<Y! ?ݐ"@ ?Ӑ12 @02 @02 0xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxXX 000000000000000000000000000000000000000000000LL㿘<\#` < +@1@@2 MI. @D @ h "6<@] h&& <& P& & &  "6 8& ,& 0 0& 4 8& & @ & <  & @ "<<."@Ӡ & D & D D@ъ H0 +C `0+? @ 㿘<\#`<  +/ ??#c :  c !<\<  +:  @ @@& "h0@㿘<\#`< ! *   " @&   @& @b 㿘<\#`<ր!H:*ڒ @ڂ <\"h # @ 0 !"!0"H`h2"@"`2 ?  ffff*(@ "`(H`h2l@!`!ffff*(@ "`( ` p"?<*Y!ph @Ӕ @:  @ߐ@3㿐 #? o<#@ ?&T@  @@ 㿘@& (`& ,` t& 0` & t`& 4@ @m 2& H<"& H  (`  . `* `" t< ( " H*` ( " 㿘  (  <  0)̐!?& & H<\#`< )!@  <<!& H#& H&  & p `@ "㿘 <\#`< !) `   `6    < )"( < (& H? & ??c 2  <`"& H& p <)j"X<! & H 2& <)`"p?& & H㿘<\#` < ")P < 8!`+& H (*`  *   tb@v*` & 8<֒)8" t` < ` 2  <  >< & H@ 0& & H㿘 <\#` < ")  (<"& H*@ *`    8$ $ $ p$ l 8@ $ t$ $ $ x (*@ *` @ `<(#?&  ,@ <#@(ޔ & & H㿘  ` <``<#<#L& H 8  <#L& H ` @+& p㿘<\#` < #h( < #̀`& H    `@P"㿘<\#` < #( <  P`& H@  (*  * @`@& H㿘  <\#` < #(j`<#pD& H`= `24& <"*` €<!5& H" 2  < 8 <4 8"&& H  <#L& H  8a<"H& H<#& H `  "` 2  < #($ & & H㿘   @   <\#`3< (  /   4`<  (( $<\#`< ' X 62 2   ? L ?<  ' ?& 4& H  4 82 8<"(& H 2 <"`   ``<#L < 8!<"H & H<#& H ` "`& 㿘 ( *  * @ `<\#`<  '    <#& H ` C"` <' ؒ?& ;& H@Ґ 6 ` 2  !   t  > c < 'e! t< > . >& t& H& H 0Ā & c < !('K 㿘<\#`< '@!H@ Ȑ< !h& H& ` `@I" 㿘<\#`< !`''  <?& & H"& H㿘 `  @ # В # # #`, #`0 # ( #@ 㿘<bh@,M" H㿘   & <#4& H =`1%<"*` € 2  <8 <28"& H  <#L& H@? <"H & H 2  <#& & & H㿘  t   <א!&l<\ Q ?  <א!&;<\?`0<#*` € = ,?. =<\c < &}!@<_! < ?. <<\c "<< &j"<N!<&d"@<\<א"&^?<\#`< "&T& 9& H@O 2<&H"<\  * <א"&;<\#`< &3#( `$ "$ <`2  <&'#x?&  & H<& #X <<!. <& H 20i20(``p" `k c`l @`  '''''''쀢&'<\`   "`` '` @" @ ''  `@ `""`  < !<!< <א#% !???<# ?<@2?0   ?ǐ#% ( E?ǐ @'''''''쀧 '#<\`  ' ' "@''   ""  < !<< @!<c <ؐ %P㿘#``N 8`, 4 G3<3a <@ B4 @@@ɴ8, a* 2 @& <<\#`".& 8a<ؒ" *`  4 8 8+ %!& 82& 84  (!, <3ᘑ* 2 @& <<\#`"& 8<ؒ" *`  4 x 8+ $& 8㿘V    *   & ` :&  *   &  `  :&  & 2 <$ː !&  * ?`6   㿘  & @W㿘</ D @A! @M0> Ă & @v@;?@ H && " !" !" " @- @ Ȑ `U @   @㿘<\#`<ؐ $W` @/@ڐ㿘  <\#``< a ``  $.+`@@" ?& @ X& p@ ٖ 0@$ ?0@( @ג*@$``$ $  " < #!8 `  %</!D!0 @| <3!`Đ`Ȓ@$ \ @ӄ 6V? ??6 ?<!X< !X#’ @ `< ax ``  # D @7 `D<& pXl@ P  @40D @. * $@!?& @ X㿘 ` * " @  X㿘 H/`<\bj2*  H  <`  Ѐ d`#?! @ 2`<\#`<ؐ!#2 b@ ̀ " b* 㿘`̐В<\#`"$ < !#$ `  &`@ @!<\# ""<#""쀥 2#<""0G 8 <ؐ"`"   8  20`\?`4`<ؐ""ڒ%t # <""ʔȀ4Đt@*``ݔ@ 8’ !㿐<\#`<"# '?`'?'  @*$ $>  "@ <ؐ""|'' ؘ $  @ ܐ $  2*@   * *  $ $  2<ؐ# "H    "@ `) " 8 +< c0")''   $@$$!  ` Ȁ $̐" 8 t+< cX! ĐS % @  $ $Ȁ@   0"!  "<!Ȑ#!</  D @T @`@  05" <h!`'<؀ @ @'' !  䰦  $    < !{# 㿘   <\"t@"& ""@<\#`<ِ 0!`@d  @"` " 㿘!</ D @ܞi @㿘 <\#`<!1 H</ D-<\?#`p  @йFp " "@$" @п &# <ِ p! Z   ` B Ȥ : Š 㿘#<\c <  "쀤 '<ِ  ْ* 8@2$ 8[c <ِ  Ȓc <ـ  (a `  t * )  : 8 !㿘"쀤`G!<\# <ِ!0 # <@ (a @`  t * )  : ( "  8 @ @92 8 @``@`$@@v@ `X 8 8p !㿘"쀣 N  H   l P  P@ : , $  @8 / @2$ 8H/`<\"lj@2 @ ` `$ @@bl@#bl*  8 !㿘"쀣 N  H   l P  P@ : , $  @8 / @ϣ2$ 8H/`<\"lj@2 @ ` `$ @@bl@Аbl*  8 ʒ !㿘  ? b<\#` < !`<!<ٔ! ?& @& p㿘 </ D @#%Ȑ ` g @+Ho`<\"lj@2S @ <\#`<!_ ?& & p @ @  l `2l$$l*` @ `?㿘 ' <:H/`!<\"lj2 $ @B@  #</`D!!0 @Χ4<3!ĐȐ@ $  @ί"l* 㿘 <\#`@< !` @?&  @`2 ?&     `p?` "@5 @㿘 @@  G?  )<ق @Ώ?` `p`P`P `l : @,  & !@2``pH?0`p B$`<\#`"  }! 2? ?@ ֐@ :`؀ 6?4& H/`<\"ll2C  `@`& p @ , 0<\#`"`< <" `<& p@KcT@ 㿘 <\#`< %"8  *@$ ؐ`H& p @ 㿘  ` = <\c  < "P 4 8</ D @͖#@*  " p& p c?& <"?&  P @ D @͌c < "  㿘 `  $? !   4 8@? h$ h" 4$ 4@ &  h @H0?& 㿘#<\bx  <c* $bx<\#`< "bx& `$ ` $ `$ `$ `$ bx`$ А $ $ $ $bx $bx㿘 6` `$& @R <\c < #c!</ D @h$`4$h@$4 @㿘  ` >   ?& <\c  < #  40 8</ D @M h` `$ h$`& {D?& D @ž < #X  `2 <ʐ#㿘 ` `& @ߒ <\c < #!</ D @ h$`$h @̌㿘` @ !0p@ 㿘& & &@& @& 6 . 㿘<\#` <ـ`#<#<ْ# !! jG  ! r @Ĉ`&  & $ `? & ( **` & ,& 0&  & & 8!& 8<3!& <& & &  & & & & * &  0 &<" ؒc0& <& #& L<ِ#& D<ِ#& T<ِ#& \<ڐ  l& H& @& P& X & d& ` `"`Ԕ" & h &"`c <ڐ 7@㿘  `E?!</ D @˻Hb$b`&ba& 0ab`&<<"b`$b$b @͞&<<<"c`$b$b$b @מ&&  D @˞   @㿀<\#` <ڀ  `< <ڒ  Ք    Ԗ䒒 6T<ڐ ƒ .䀊$ !! `! @Ü 7# 7``  ? ? 47ꀦ  <ڐ 8  4 㿘<\#`<    Ð 㿘!   & @ @@ H@ P@ X! x #㿘 4 8@:  @| P! i # 㿘<\#`<ڐ KҐ</ D @֞c Ȑ ` @ݞi 2 0р2 @02 @0N2 @02 02 0㿘Ho`<\"j2  @& @*`  <\#`@< !P㿘H/`<\"j@2 @ " |@b p<\#`@* < !hƕ*`<& @" & @<3! p X9 b* 㿘H/`<\bj2 `$X $<!<\c @<`$` !`` <!<ڒ! < <!!z 4?`t `2@&@&` &" "@&`&@`2@&@&`&" "@&`&@&`$<\#`@<`  !  <!<ږ! G b* 㿘 $ =H/`<\bj2"  $$  "@"  ""& && $<\#`@< " <!<ږ! b* 㿘<\"`2<\<"<\" #㿘<\#`@<`  " 2<3<!<ڔ!<3!Ր `t `|`<̐#0 @2 `$@&`|` @Ʉ`$U #<!#`@<`$` !`` <!<ڒ! < <!! 3?`t `2@&@&` &" "@&`&@`2@&@&`&" "@&`&@&`$# @<`  !  <!<ږ! i <ڐ"b"&` ` @:`p`&`D# @*` <`!hM*<&`@" &`@<3!`p`X 㿘Ho`!<\"l2 & =,`㿘Ho`!<\"l2  !@d,`㿘<\#`@< #?& @& p㿘  H`<\j2 <\c @  <3<\!b< ѐ#8 <#@ <ɐ#h?@ $cݐb | <ڐ#Ԑb Аbc @< !0<\ $"& @&& p"$ x "@"  ""& && $c @< " <!<ږ!  x  | & | | p* & |<s"Hc  @/ t`q u $U #<[!c`@< $` !`` <!<ڒ! < <!!> 3?``2@&& $" "@& & $`2@&& $" "@& && $c @<  !  <!<ږ!   <ڐ"&  @ݞ<\"  # c @Ҟ l #c @<#Ȑb*㿘H`<\j2 <\c @ <ۀ     <!<ڔ!  c @ <3<\!b< #8 <#@ <#h?@ `$cݐb | <ڐ#Ԑb Аbc @< !0<\ $"& @&& p"$ x "@"  ""& && $c @< " <!<ږ!a  x  | & | | p* & |<P"Hc  @  t`q u $U #<8!c`@< $` !`` <!<ڒ! < <!! 3?``2@&& $" "@& & $`2@&& $" "@& && $c @<  !  <!<ږ!  <ڐ"&  @ƺ<\" # c @Ư lߒ #c @<ǐ#Ȑb*㿘H`<\"j@2 @'<\-<)< @ <3<\!b< #8 <#@ <#h?@ N$ | <ڐ# 2 @< {!0<\ $"$ @$$ p"" x "@"  ""$ $$ $ @< " "0!Q x  | $ | | p* $ |<@"H{  @ t`h l $L <(!`@< $`!``"`!`!`"/?``2@$$ $" "@$ $ $@`2@$$ $" "@$ $$ $ @< `!`"0! `<ڐ"ڒ$  @ų<\" #  @Ũ lؒ # @<# b*㿘H`<\bj2   '<\-<)<$  @ <3<\!b< #8 <#@ <#h?@ B$ | <ڐ#| 2 @< o!0<\ $"$ @$$ p"" x "@"  ""$ $$ $ @< " "0!E x  | $ | | p* $ |<4"H{  @ t`h l $L <!`@< $`!``"`!`!`"/?``2@$$ $" "@$ $ $@`2@$$ $" "@$ $$ $ @< `!`"0!֔ `<ڐ"Β$  @ħ<\"֒ #  @Ĝ l̒ # @<# 2$ b* x  x㿘H`<\bj2  x  ? & x |@<\c @  <3<\!b< u#8 <#@ <m#h?@'$cݐb | <ڐ#aԐb Аbc @< T!0<\ $"& @&& p"$ x "@"  ""& && $c @< " <!<ږ!(  x  | & | | p* & |<"Hc  @Ӟ t`q u $U #<!c`@< $` !`` <!<ڒ! < <!! 3?``2@&& $" "@& & $`2@&& $" "@& && $c @<  !  <!<ږ!  <ڐ"&  @Á<\" # c @v l #c @<#Ȑb*㿘<\<"`p"@A 㿘& & p㿐<\#`@<  8h t 2 D<a X  D`" $ D@  X`  # @< I!+ H`#@H`<\"j2J   ` @ t  "* "* " D'<9# @<   <\"`@ 2 <  @'H`D@h` l%<9` h'$ l$D !   (! !H`D@Vh` `2"`$D# @<   ` 2  "  # @" t< ! t>!$ t$ $ H #6 D @< !  L`" @ H "  t!<  " 8 8 " D@$ 8m!0 @\㿘<\"`<`!X0 |  <W!x?& |  @ې@;?㿘 <\#`@<<!<\"+<\-<\bpbp@Ho`l2@  2  x,`I# " $,`<!?@%#9## "@"  ""$ $$ $# @< " <!<ږ! ,`l bp! bp @<͐!㿘` `  !<\'<)<\_Z # @(0$`@" @m `# @<"(1<h!P`   ! !`"Ր 㿘<h!P<\_0b @_㿘 @`<a& h& L& X& \& d& & t@ @& t  . >. =. <<\|<\"<& #& `"|& & "`#" @<\#`@< "P`<"p<ۖ"9 㿘j  "< `"`2:`  @)㿘<\#`@< " <#@<"В?@$c0 ` "` "<\" ""& & H/`<\"j@2 @c@< ֐!0 $& @#& p "@"  ""& && $c @< " <!<ږ!  | * & |*  X   c @< !}  " 4 4 " 8@b 8 " & 8  " t&  t & c @< t# P`" t@ t & t0 P`@㿘H`<\"j@2t @ <\b  @  `@ @  <\ $ c @  <3<\!b< 0#8 <#@ <(#h?@$cݐb | <ڐ#Ԑb Аbc @< !0<\ $"$ @&$ p"$ x "@"  ""$ $$ $c @< " <!<ږ!  x  | $ | | p* $ |<Ґ"Hc  @ t`q u $U #<!c`@< $` !`` <!<ڒ! < <!! 3?``2@$$ $" "@$ $ &`2@$$ $" "@$ $$ $c @<  !  <!<ږ! k <ڐ"c$  @<<\"k # c @1 la #c @<I#Ȑb*㿘  <Đ?&`   & L& 㿘H`!<\"j2F <\"/ `|  `&`|  @ў`p <"Hb  @Þ`t"t ` w<\`$W $<!<\c @<`$` !`` <!<ڒ! < <!!А 4?`2@&@&`"" "@&`&@ &`2@&@&`"" "@&`&@&`$<\#`@<`  !  <!<ږ!  <ڐ"&`  @n<\" # b @d`l #b*㿘<\#`@<ې# q<\" ? " t 2   t$ !$ t$ Hm  㿐 0  !0<3 j2v `!<\<\$"bĄ @מn"#Ho`j2d >?"`"@昔+ *@ @ "*H*o` !d!l<ےcP@<\c @ <#X<\b  1<\"p+<9 @``? <\2 <\"` "p p @< ѐ#x  "p` `W<\'H`cD@Bh`)<9`?'"%cD !<\"p !  "p` `"!H`#D@h` `2"`%cD @< k# Ⰰ 2q @< `#<\"`< Y#@&e # @< M# 㿘<\b  %<\#<ܦ  !"   @ 4`!< !"  Ho`j2Z 昔+ *@ @ "*`㿘 <\" @@<\c@!<\#<\<" @ bb" `"$b<ܐ `  <<\ ̒b  <\<ܒ ې b $bbĄ @  @_㿘<\ @j<\c @ !<\<\""<  " "!<\? X$"'<\<"  '<\ⴀ   c @I< !Fb  !! !`c!<%<)<\ @ ~!  c @  uP0ː"ⴀ cHo`j2 昔+ *@ @ "*`b @㿀<\" )< =!p%< $     <ڐ!<ܞ! ,  ( t #\ #` p#h#d H#l L #p`2 $2 0 2 @0.2 0f2 0ـ2 0Հ2 0퀐2 02 0!2 @0@2 0H2 0Y2 02 02 @02 @02 02 0)@2 02 0$@@ @ @2 0;Q@<\ ?Ї(@2?"@ <\ ?Ї(@?"@ 㿘 <\"Г.  `2` @&`㿘 4 @㿘 @><3 2 @& $㿘 4  <¤#*`  `Ā$ 2`*`㿘<\#` <ܐ"  + *``<3 2  a@< "" 2 `*`  `@ v  2 4<3! @ & $` <3("@"`2` "`㿘`@  <3!`$@ , , @  2`4`€  $ `4@ Ò` ( @ @"@"@㿘<\#`< 4 "P㿘  <\c < 4`"p   t & 4?&  4㿘<\#`< 4" q 4`€㿘<\#` < `"4` 4 \  4` <3` 2` `  4 "㿘`` ?` `6``   4  0㿘  <\c   4 4<`"  ђ& 4㿘  <\c < 4`"   4 4 t  㿘  <\c < 4`#   4 4`$€㿘  <\c < 4`#0   4 4` €& 㿘<\#` < `#P4` 4   4 ? # @6  4   㿘<\#`<ܐ#  ߒ 8 <\"c   & 4& (& ,& @0 㿘<\#`<ܐ# =㿘   2` 2` 2`  㿘 "@`"@`"@``"@?" ?㿘` <#a <ݐ  R 0`` ?㿘<\#`<ݐ 8 A u 8 #p<\c ! & & (& ,& 4֐0 㿘<\#`<ݐ h #Ӑ㿘<\#`<  F 8  - 6 @ 6 <c6 6 6 6 !6  4  6  6 6   6    2 <* 2@ 㿘<\#` <ݓ.`. ȓ2`Е2 t 8 <  6 6 6 6 6 6 6 $ 4 㿘,`@2(  20  2+   2& 4  6    @  `     2 ?8`?㿘   4<3&@a``@ d&@`D`&@`@`H  ?@ `"  "&@`&@&@`&@`?#@`  @&@``@ 2&@ &@: ? #&&@`&@``4? ?0 "` 㿘@```<!@a`<ݐ!  0` `  2` ,`8& ,*`@㿘@ @u $U   $ @ِ!& &  `& & & &  &  @ 㿘<\#b<    aX ̕:    @ :    @i  <ݐ!x @ X   @h V㿘U>   &6` & <& & & & & &   㿘U&㿘!`U"  &?@e!``U  $!L`U  $!P`ΐ t ` @$ ,  @㿘 ʐ t!P "!LU!L UU f㿐 <\#b <``!<!<ݔ!ȗ. -2. !   2 ? ` , ` 4@@  耦!Ho`j2~ 昔+ *@ @ "*`㿐`< `# '<<a t"@`&a ` $ a"@`&a  $ 2 &a8&a<&a@  `?# # aH  aT   <#'@㠀 <<#@ 2<\ @ <` ӑ,`@Ϋ-  "<&` &`$ ` "` $@ ``$ $  $aL@R@OaP `+<\`aL <aLaP$@㠀 2&@!aaP <\#b<@!<#$@#b<6! € <\@ "  ?$@: $  aP  <\@Ő<\#b<"@ <ݐ"0 <\<ݒ "X ` "`< "ct "?a"@`&a  $ a"@`&a  $ a"@`&aA <\#b<֐" ` "`ct "? "@ ` $ @$ Ð" <` "`5<ݒ" <` "`| "@ ` $ $ ``"@ $  $ ``"` $  $ <ݒ" <` "` # <` "` "@ ` $ i$ 2 0}㿘 @ ` <o#` $  <\#aJ< d#0E $ . $@ )<\#a< #T "@"  @"$@ $ $<ݐ#? $  @Ϟ!\H #0#a< . ``2@&& $`" "@& & $ . $㿘  <\#a<ސ!!\  #p  @ '<\`@   @?'''''<  !<!<! <`!(@#\㿐 < !<b$ !<x` $``  @` '''''''<!<혖 @!<<\#a<`!``@㿘"쀤 <\#a  $<ސ!3  `$  8 !㿐  ` ` ` U \ < & & & &!D6 & p @6    @Q&  `"`` "``!</ D" "@|` ?$` ` `<N h$` `$$`@ ,`$`` <\` <\ `$ @ <\#a<`6  D @ܞd􀢿.<\c! <ސ!! !</ D @>` $` ` < h$` `$$`@ ,`$`` `  `$ @2 D'!!</ D @` "$` ` `< h$` `$$`@ ,`$`` <\` <\ `$ @  D<\#a<`Ӑ X D @y?㿘  !*` $  <$ ?? <0"  <τ<<"c" ," ( 㿘<\#a< (! ( "쀢<ސ"0  `" 8 !㿘<\#a< ("0"y"쀢<ސ"r0 $ `@*$ 8z !㿘 ( <\ݐ0#a<""pV"쀦  `& x  <\#a<ސ"=  < 1"0u!<ސ"* 6  € '< '# `  ' R< #(` '   ' >< #H 07ꀢ#  < #p#\! #< *2cՒ @Ք $  "$" M  `` "`Z㿐  `<\#a ` <`# `$3   `$ @P` "-`<U!</ D @- `$ `,`$`?$``` `  `$ @ !<`}  D @#E ` *8 "@ @' '  Ȁ?`<`8`$`< <`8U#@"  *@$`8!<H k ?`8 9!<ߐ 89!</ D @ɞV` "$` ` `<( h$` `$$`@ ,`$`` `  `$ @ !<`  D @ٰ?   !  <ߐ ` $$<$`8 O!<ߐ !  `>  $!D$!$!$ $ $ p!</$`8$`< D @f` "$` ` `<Ő h$` `$$`@ ,`$`` `  `$ @  D!<` 2 D @S `s`  o"` ?28`!< !</ D @%` "$` ` `< h$` `$$`@ ,`$`` `  `$ @ !<`m  D @05<  ` !</ D @}` $` ` <P h$` `$$`@ ,`$`` `  `$ @  D!<`8  D @ޞ㿘  *@ ""#<!㿘<<Ӑ#D ap& (& , (  <\#a< !<А#$"#a<!8<<ђ` $"$"& <& 8 㿐''<\#a<ߐ!`` <ߐ!a\` aX@@ <ߐ!֒`t`@ @`@ @`#</;?`D @W @Pݨ   D  "@"  ""$ $ D @M ! <  @ : $ , $   &` @| D`2@&@&`&" "@&`&@ !H`<9#D@h`a\ aX'&a\$cD D @YH`@h` `2"`$cD D @žO` " D@@`"@"  "& D&`&@ @!<ߐ!  |?z? @!" ( <ߐ" @: (@!<ߐ"8 ?2/```"P?`p "&`&`p!<ݐ#8ϔ`&`` @r26? `$  !< U` N'?aH$@ *@ * *  `*@&aH `Ĕa?&`&`&a4"@a` &a0&a&a "  & 㿘<\#a< "P `) p "& & p!<ݐ#8q f& ` @ `$  !<[ ` M㿘 `2  p<<ߐ"pbJ#[K? <\& p#a<ݐ#8< 1`,@ `, p "& & p<\#a<ݐ#8# & ` @ƞ `$ <\#a<  ` Mh 㿘<\#a<ߐ" DL   D?&< @̐`$"& & "& 0"& & 4V` (&&  2<ː"  "c *& 6`M$"  & $`!< "㿐<\#a  <#(``<#X;?ꀦ`   蓖 0'     '` (€  '@ "n    c!<ߐ#^ 㿘<\#a<ߐ#P   0"" 4""      ` @2 6 " $`   "@"  ""& & $  . $   @ :   Lq0  <߀`#`:`㿈<\#a<  77'G㿘<#<&@#&   & & <\#`< 0ْ <\#@,  2& (<#& <\@* " ?  <\@*  㿘 ` ? "`<#?&@   & <\#`< P<#.&`& ` & <\#`< h<#&!H @<!#&!H6 06 ,6 ."&! "!"@`&! "㿘    (<V&@0 @L H/ 6 6  = 9 @` 0.``0@`@ .``< .`c6'(<## !H "!H  ! !  ! ! <&㿈``,  `8''''<\#`  <  ``,  ` 2`  `<㧖 0$@&` ?&  @` "` & 픒   ҽ<ؐ훔 0 ` * `<&` ?& & HX'''7<\#`  !< $  #Ȓ@@y ? $?$?$? 'Ē-  ?㿘<\#`  <   | 8 6 8 & H`2 ?& & H2 " *@$ 嫐 <h!<\#  <.!3 Y` 7'<!P@(   .# <F!`? ?'7  'Ȑ"? ''ԒД # <!+㿘  o 6`"<\Ȑ ~ 2 0    & ?㿘<\#`  <! &@`&@`&@ `&@ `&@$ p$  ` 2@ "f@f@fhfhffhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhfhf@f@㿘<\#`< "`<ؐ# & H& `P& p㿘 <\#` < " < "`!& H (* `* @`  t鱓,` & 8?&  $ $ $ p$ l 8<ْ@$ $ t$ Ȕ$ x& H㿘<\#` < "Y  <ِ" & H7 <ِ" $ p$ & H㿘<\#`"<< ="<ِ!T& H@㿘   <\c  < "(  <r< "`& H`= & @`D@ 2  < #(   @04`2<ؐ"*` € 2 <ِ!& H#&  2 ?& `@ @ << #@  #h L%܁㿘  <\c < # ݼ& H   `?& ` @  `㿈  ''''<\#`< #  @T` M  cᒐ 0< {#0+8 2c < m  @G`䳒??& N <ؒc|$ Hc <  8T " 㿘<\c܀%     <<<<<<!<#<%<'<)<<<1<3< p &#x&cl c"#"ct""###c|$#$c$$%#㿘@&   ?"?`@[@@`  㿘  @J ? ?"`"@ 㿘@> ?&&@(㿘@  2&`?@`?.&@㿘.``?%< ?  "@ِ (?h0 @@"@`㿘.`  @" @{  & ?`4 㿘!<\# <] Ē $#㿘!<\# $#㿀@`"' `' c<; @< b <|#``~`` ` 2`r`*`  @d,?А  N*@ *`ВД @ N  <|#` ` `N?ꀦ` <|#` `   ` 2# 21-<; @  ,? <`@4 $< @@ $` @<  ,@ "'B>㿘@<`a`` @Z``<` a `@R` )-<` *@`@`@A0` @ %< `@``@3@`@   , `*`  &@'  &&@ '㿐`<@a`` @ ```<`  `aH@#\`  (-<`*@  ` @0  @  %<`@@ `@ `  - ` *` &@'  &&@ '㿘@<<\#d"<]<!`<]!( !<ےb" ," 0㿘<]!(!ߐ㿘@ <\#d"<]<!`<]!( !<ܒ`@" ," 0㿘<]!(!㿘<\#d<!!<]!(  <!!e 2$!(K㿘<\#d<ɐ!<]a( <"a(!! B((dd(((((dddddddd((ddddddddddddddd((dddddddd㿘 H/`<]b8j26      @ &   & @ b8b8* 㿐<#''H`<9#D@h`# '##$D,/<l3<]#<]<]"<* aP8)<] !H/`m@2 @|<"b@ @"b<$b<&b@b<b<@ | @? $b< "@ 2`-@  )"4 "H/`m2 "4%"4-     €"` 2  H`D@h` `2"`$D! * 2   :`* (<s| ` *    * 2 `:(* <sa|@  ( "@:((<s!|  ( *"㿈 ' '''<;@ ?@R    " 㿈<;@ ?@>     쀢` ? $ $ 㿘. 6 . * <c*  j@  "k@?0 Ȑ 㿘` 2 `! `0`"!2`` ` `@? `@?`02``O?`H 2` * 2  `@:  ?* 2` <5:`!@ ` `"@  ᜀ <   `" " "` X  X&`4H`<]8j2 `*`2`2`*` *  * <#`` @  `(`` @B"`( jJ  @4  &`0$  @ | 0`"0` 8 `4 2`0 `0`2`0 ":0`* 3  2 0`@:0 03 @  2 `@:  * `` ` 0 2000 20&`0"0`0`<` 8 `0`4? &`4c`0`2``  ` ` `2  Ѐ      b8b8*㿐2` !<. d @r#4@`4`* @*`` ")`< `&# !<c#P@*` 2c <ؔ8 * <#x w#\` `` <0`<0   2M<5aaܢ  "aܸ   ? U<5aa "aM#6  +2<`<2c* @`  * @<2c* @`  * @H`<]8j2% *`2`2`*` *  < * c   ` € `2:?   ' +. * * 㜖  2" H<]L @2}H/`<aPj@2 @b4"H#b4*@ d`m`<ܐ#<*` €. * 㜑* ` @@  `0`"M `0 8 4 20 02    `," <`#`,@#``0`"`0<` 8 `0`4? "`4H`0`2``0ł`` 2 $ 2 `@2 `@2 8 `,(  $$@ `@ 4`4@&#`4(?`,<"`<,##`, #`#` #`0 O#`02 `(8`4 "`($$ "`(` #``(&<`#`(`4$#` #`#`#`4#``0`<` 8 `0`4? "`4ɐ`0`2`G0`D ` =`$ 9`@4`@/`*,`(  $$@ @ ``44@& 4`(?,<"`<`,# ,` #  `0#@ 0 @8( g @8*08 26`0`"2``+2 @``@"@ " ߀`$ ۀ =`,``$$ "`,` #``<l<"#,`a|" <]* @ <]#"<"@"<?"<@" a| @? #"< "@2` 8*` .  2.  * #`#`#`#`#` #`$㜑*  #` #`, #`$7#`(0@€ `㿘` " ` *2  2 ,* <* c !<  <!<#a u #8, `$ * @`2 @%  `"` `2P` 2`  @2`  $ `` ` 2 @ ` 8<`@   <`  !<` `Π /  @C,` @W 2` 2 `@ `ȑ2 `@,`0(   !<` ` 8s @,``` @E @A`@ € `@,`㿘`$` `!<`y Ȓ`J`( ) `2 `@  @ $`$``(  <$`( @$ <€`(   `2 @ $`<$`#! $ $`  㿘 $` @"?<&# #2 0ŀ2 @02 0R2 0t2 0ր2 @0Hڋ@㿘<#b<(  0$bȁ㿘` @0@ 㿘`   d@В@ .`  `? < `"2  `,,8 <م2`4( ` (#:  <|( 㿐<#"Ȁ52  "(<3!0  c  2b<)!Pb`0"b ``*` *  <{* a\  < < 2c8* @`$ * @"$ ` @"`@Y  `= @@* @@7`&`` * ` <!h< <<]"8*@H* %@4   ` @ϒ  @ ^ d& q'` !`     `  _Ð ` `ZdӐ 0V $ `  <! Dd` g   @T d8  ( dt "%d%@ zHo`8j2I <cb  !<^!\Ho`8j21 <cbȐ %`0`"b<㿐/ <:!O  <2" G @O @  :      <3a>  & ("a& T  `2<<"P'  !<   L@ `   @`!< <" 㿘  ?l?    *@  & |  ?<ʐ"0p "< @   ] *6 6& @5` d 8`2 <"0U 6 ^& ?逢"& 2 ; $ #`$ <"<@"@D"D "  "  X}"X ^z & `* h  2     .``& 2   #$.`2   `"& @ "@& & & ^6㿘 ` <]"|*` "&  ` @ " &  `"& @& 㿘` <]"|.`  €  $` `@㿘  2 2? $ -?<" @@ 2 ]   & ]& 1& & 6 & & &  d@ג  $@Ԓ @<|*`" .`2 aC    "  @T@ !! `2 P?  2<J?;@ h@   9?  |`<]"|.`@ +?O h x @& @ $@`& @`& & & & Ȕ @Ő d6 ֐   `J? F?@Sh 'h $ 3  * 7l @ `3  *   'p7t'x@p'   '|T@ !! ` d '@<;@ h@[    ?㿘 "f? *. 2 2  <#  Z? . T?*  * <{a\      7` "`"`-`   0Ԓ , ' k" ?"?<;  <| c*@ * &0  ? ?㿘 2 *,?6  <#H첒 #? . ?*  <{a\*   `<]"|*` `"  ``" @  &  㿘 "6  *. 2 2  <#h *  4& ] . *  <{* a\  4 <#f <]b|* @ &  `"@<]|(@""@? 㿘 <{?!\&`)<]. "| 2   @$ $  ̀* "|" 2 02 0ʝ}@j@<]؀ * 02(2 㿘. 2  <} @ 4 1<}!<  [@{㿘/ &(<ۄ ,(ψ`   .@* <]``/ ? &( (` "&@##/ &( (`@` /  ( #,(1<ܰ".`/ & 㿘 Ā " B &  Ԣ @  " B $  Ԣ`@ 㿘<ّ*2 2 c4* @ *  & ^ 2`` #?$*J@"@ !< 0Z}@N  Bߒ & <C p@[$`  & !<Zb 5 `P㿘. "* "<ۑ* c, Ԁ   =   `@  @ )<`  @ ` 0z `@  B p$Ġ ` "   @"  `<Ґ ؐ@ ) $)* !<!(Y2  0<  )* !<!`Yܑ2 ꯐ0/  < . <]b"@ !"    !<]( . #@$(<ܐ?b*  "@)* !<!Y2 ꃐ0  㿐. "* "<ۑ* c, < $ Ԁ^-<+<` S@`]YX4 ^ <'`$@i`/*`@ @bb   @2  ^ `(  _    ` Z,  ,_Q4 [D]w Y?bԨ ` H-`"<ۑ*  c,"*  @   `? "  `̀? <] @ 6 - @2  {`@ `<]-#D@  <b(@k@`}?-`"* "* #, ϒ @   @*   `  A`@ &* "#,ԑ*  @ -`   $, $, Z`\ @<]#%_ 28?&* cD@"#,* $€ $0"@ !<w"@j?ꀢ  "<}-`(* *#@<ڒ ##T" 㿘`-<ۑ. "* "* ,```. "* ",* `@<2"hP?  € D?ZJ`*`*\} ``"%* "* ,```z`@ @.  . `  ͢`@`%<}<]* (%@ ,"+`" *  < c0  "`$# 㿘. "<ۑ* " c,* @ U .`iؑ4  <ٓ4 *`#4 ` <`* @`<<" " .  (  B?. "* "#,* *` * V4&` 2 ]` ,`2 2 * 4 `*` &` 2?`(€  !<<"~? $!<"~5`q 㿘T@ !! `" ? *  `<]#D*` ` ` 4?b]"Tbaxa"%.g?0ݐa%a'հ?ꀢ:( b^(b`?0ǐbb3bc8?02`:`*  ` /   <; p*<} `(* `@&g Y2  *[G  0<ڐ#0 c" <; M0<ڒc0 #@&G w<;<   . ? g  . ? [ <}* `(* `@ & : 6 ? E  *@ <} (*` & ? "3 01@ !! `2<$?;   ? " *?  02 <@  ;@?&0?  +<ۅ( ( c,(`@ "@㿘 *X] , "* <ې",* " 㿘 < , +*`" * " * `k?㿘 < , +*`" * " * `j?㿘 <". "<ۑ* c,"* `@` `<#?㿘. <ې"*  "c,* `@ 2 3 @`` ```@€ `" ` . `. @€ "* ",* @ 2 ߔ 㿘<斐#0㿘  @R ԝ #㿈 4" ''쀦 ' @a & <&& !L& y8   @204Đ 㿈 '''& ` & <``#PO <J#p  ˆ <#B @㿘0  !0<3 j2  ɐ !d!l<c@a8 ?""&   @< '<]!Poc j2 *ToS   8 o  @Ş`@ 4 H/`l2 4$4,    €"` 2 0o  @J 㿘<ےc,!<}#<<]# Xb`$ ?   # # "@   "  ` <ؒc8 X<#"`$b" $<D<]#H Pc㿘 . 6  <〢(*:#" <ۑ* c," * @`2`$<,#؀.`  €2`㿘<`@<]cD !<,@@ @, *?<@ؒ`0<ڒc0`$ <@@̒`@<@`P@Ŕ  ,"* "<۔* `@< p< x <` @&*`"@<ۡ*`<ۀ#,<@@``@ @  /<@@@ @ `&* <ې",* @ &<ےc@ <]#, <@<@@b&* "* <۔#, "<   `?# <@2@I࠰ @<@@=x㿘>  <]?#D.  2?"@<䌐  㿘> ` ?!<]#D,`<| $  Ԓ @ Ĕ  `( @  㿘<ۮ#,%@ua: )* 5*` <ة* 8< c4@5 @> <; <7!!<! S]0<+!8!<!`SQ$<3!`%Ѐ $ @ِ@֐@Ґ@'c4@@ȓ> @@5YU   @ X  (  Xΐ "X<А!> !@ᘒ"@@@`* @*`@*`2` d8  d@@ǐ @ <<!㧒`㣐!`&/ 4 T#<aR㓐а %Ё㿘<۪#, Ā"K(@"F "B "= 07  22 2`   0 !mcl  0` `$`c,`$$a$@a$ő: mdܨ?<āјʋ@ѐ@2 0y @2 02 0@i[@njǜǜǜǜǜǘǜǜǜǜǜǜǜǜǜǜǜǜLjǜǜǜǜǜǜǜǜǜǜDŽǀǜǜǜǜǜǜǜǜǜǜǜǜǜǜǜǜǜǜǜǜǜ|x㿘  * ?"@@>@ < b0@]0< b@@W㿘 >@ `6 a<"*` €<"P   *@@ * z!<"X @X a @ a@4<b`@/  h   HЀ   0 < bh@~ <bp @~x*`  *"  !<"x""ؒ<㿘<ؑ6 c8 #@`$*$ * @$"$ 4!" " <0<0(<0 <0(ː" H`'D*  @*`    * ?'L''   d<]c .`4 W$ $&  U ` `?s`* D* ’@?`#' '-?+? @ݔ  *  *@ 2 @ 2 @@͔  @Ĕ   @     2``\@  @**` @ 2 @ 2` @  @*` @* 2 @2`   :<]@  @*` @* 2 @ 2`  h@y ܔ @**` @ 2 @ 2` @i ܘ @*` @* 2 @ 2`  8E`<]#ܔ @Rؖ **  3  L 2@D Ԕ @@Ԗ **  3  L 2@2 Ӓ@. Ӏ   D  D<]c  "cܰ ` `1?# ̐ @ ?  ** 2` 2 ˒@ ˀ  ʒ@ ʀ  ɒ@ ɀ ` ````Ҧ`Y<]##?*@ D*`Ĥ  @͒ ?#  ** 2` L2@ <]$D *`  , @? * +  2L3  @ $ @?# * * 4`L2@ D<]*`t Uq U|㿘  * .`6`?U =w$b "@ <@" `<:"UY0*<]#ܨ@ bH+<` (b`cܔ`՘ cܐ $cܠ  ` #܀2`"<U2<"㿘.*   @5<]@`   @ %  <"0`  #@ * *  *  *  : " ` @ܐ ܐ &܁㿘  * .`?6`U 4 $$!W@T֐0)&<] @ @  6``<`  # @ @& T  * <]?.`'4`c'LD T' 7`'|<m"4?4`<#*` ` `* @ &!: ' ' $'"`! ! U ` `?   Tc   !<ؠ# 7 '*` 'h * @`@L ?Ԑ#'t? 'p * * @2@ 2@ !ʤ!Ƣ*` ! 'x'l-?p@' В *  *` 2  2 K̒@ ̐Ȕ @**` @ 2 @ 2`  @Ȗ * * 3   2 @L@` %Ē@ Đ @**` @ 2 @ 2` @  @**` @ 2 @ 2` Lqh` <]cܕ- ?c <]"cܱ*;? 3?`` t@  *  *` 2  2 Ǥ` @ **  2  2 @L@  **   2  2 @@}      @i   @a   @Z  ` `<.#P - @` :"@  *`@*`2`<" @`  "`@3   @,  2<#X* `2 * @  2<#X*`   * '|7 @* 'x , ,  @4  *  * 3  2  L k  %`x2`  <ݵ#P|<ݮ" U l ` `?`a<]ܶ  Za?#)?'?`@  *  *` 2  2 9` @  *  *` 2  2 '<]#ܔ @ **   2  2 @  * * 2  2  <]cܶ "c <?#`  RZ㿘.`6`Ro 2 $!<#hLP#S?6!"@!R:I !@  @@,`!<#L12 3 R / !)<]!@ @@`,` #܀  0  ܢ` $܀``<֐#` Q 㿘.`6`R 2 `$!<#hKܺ??j!A@8Qѐ5 @  @@ ,!<#Kȑ2 ܛ` Q %<]   ܐ> ܐ $ܲ <܁#`` Q 㿘.`4 <4 <#, ``* @!< !< KZ6",`2 O  !<Q $@#K@`  " # ` $Q>KE6 (f`< X< `Q*`O T"T6-<]Q@ `$4    %  ? @"@  `   P@ @ܐ{ ܐ %܀P` $<۶#` 6PӐ``c6O>㿘.`6`i Pޔ + `$!R@"Pk *`$P@PĔ `$"@`M `Q PM !< JiD?` @7`1<]5 `".Pw.2 @P ܬ`$"@@``@a` @]`#ܐ #ܪ` &#܀@Ҥ`"<PJ<&#` x!<]# <!`*`  * $#-"!<ؐQ! .`2`z ǔ  I   <!(㿘 !<.@  * #4"@ @ *`<]@`*`"ܐ2`  @6.`*  .`  ` :`" @ #4 * "x<aH@wG<]c؀5  *@ 6+( -< `- @ؒؐh@w$&   * ܪ` (2 &@ 4㿘\T   "<^   <"@<"@X<"h<^  @    `0<# @.  㿘\/ ` "B<^  <"4 6<"1<"h6   `d2c<", "< <0 <0<#` @*@0 #` @`*@0ʐ"d-0<^ *`0<^ *@㿘[   "<^   <"@<"@<ר"h<^  `   `0<^  `㿘[ ` "<^  <" <"Ò<׃"h<^ *`0 <^ *`0<^ *`0 *`㿘<^   <]c # <Q<b8d   ?<",<^ <] # `k"< L ` Te Vc<@za<@zc@ "<@z <cHcX@z N, #<}x<c` @z9<@rch =#<}`< cx@z+@}Ӓ @w| <`  8t <^"`   ,  <<<}< a # <" "<}<"@b̔`#`<""<] "c?㿘??@> [! o @8 [! 㿘<#`<8糐  @x2  2` ` @}@ 0$`ԁ㿘<`"T`<`"P` <`"`<` "< ȁ㿘?!<`<` ""Ľ  <3a '$`!<}. * <}"༑*  <3  @ $`ې". * " *  <` <` "<ذ ح<ت!<"#P $  6 㿘. @*`<}@<}#|*"@ <3*`@ !  `"  :<` "<{!<,  c$   *  ". !<` "<e!H$@ <  "!2[. * $`*`@ < #%<` <K! <F!$`@<}!< !@  8*`| < 0" < |*  6 F $`@<}@ M < / <* |   @՞R`   @͞` !<_ . ",`<` "<"0 * @<~*  ",""  |(`@ `( @ž 㿘<#$, @ 2 q?  `   * @  ` `? !   `? , , @ .`* "<}`*  <<` "<ע"h, c$*`   <}`  *    `? @  ` `? ,  *` *  <}<3|* ᘐ "  @  @j㿘)<` "<} *` * " *  `''<D#<c$* `!<}   *  +@`D*   ` "<}*` *  <3|* ᘐ " <D<$( ?""( @0<}*@|" ? `8 2 ` 20P"`0``4㿘 !< : <`$#D*b#D ?<"0! #D<#$*`@`2  #D #D *` <}@  #D*  @ " 㿘<`"l`<Đ"3?@]?,?``<`bT  "X"T `<` <`"T  $"T`Ȑ<`?"P< b `?㿘  *@8  *`6 :` 㿐. <#$ ` @ `   * 3. <`* bR. @*`<}"@*  `@<}#|*`@` !<3 ! `" ?"'@{s@{ d@z `'! ` " "`㿘<` "<},* "`*  `8<}#|  `  $@ , * *`@` "*  `2   * %<*D:.?2  8*`D:`%   Ң`㿘<`cX#<3 @H`1<!Pn2Y!H"cX"!H.Ho`</Ph2F1<:!T&!T(`㿘<b@<^<`<`"`"#h㿘!<` "<}*@ *`"@  *`@ `<<#H՝  "  "<Օ#x<`"h @ @4!<`#hl<3a<#p $ $ 㿘<`]#h<`bh€㿘<D<#$*`@`2<3@ 0!@ !<`  #h>$ $ r 㿘_[^<`c|  "c|_n㿘_L^<`c| 2"c|_`㿘<~ a` 2`<+#aܠ `<%<aܐ aܠ  `a<!<`a<#<`bh @ <D<#$*@V"_^UH`<9cj2p  <^ !<^ $  %<@ 8%`a@   2<$ <#Β <Ҏ# #D<c$* <^a!<#<2   $b@ $""%`$$b*^ՐZ㿘<#D< $*`@ `2  ?0+*  # #<}#D*` `€   #D<^ $` #D<` "#D<{#@#D#$*`@ ` "`?㿘Ġ : ` <cD<#$*  <} `!<`"<* cT*@ <3! `*"@  @w^ $" cD<#$+`<^ $  "<` ". <: 2 @?㿘<<}#4` '<`#<} ?  <3!<`$-"<#D*` `€ ,  <^d 6 <^ $` #<<` "<cD P@rcD<#$*@"?㿘C  ? ?㿘n ? g <` c<` ` ^ \  㿘<#D<$*`@` 2 ! !   ` D <~D*`@`* "`<~! ` "# 1<`D1<`#D#$*  _!,??2 D" ?D1<`D#$*  `?"  <}* @*`"@*`@` @x@w#!@wߐ!<]c "4   "*` *" *@xl2 !@wĒ! ` 8"`* @*`"@*`@ ` @xV2 !@w!  8D<^*`,   #$  ,` `   `  D, *`"@: D `*`@*"`: 㿘#<cD!<~<!ܛ* c$@     <} `!<3 <cD !*" ra 㿘<}`< `! ` ` `㿘<} `<` " <Ɛ!8<cD<#$*@"<}  `` ``@ 0 0  ƀ  !<` "<Ҡ!X "<}*`@ (`@ (`#|@ @r<`"h` €   <` <}* @(`@(`c|@  @?p <` <}+` * " `*  < <!e Z <` "<+` * " <}` *   8 I < N! ``<H!;<  <!  <!  <`"L` <<!+N<%"<<"<怊" <"( << "83< !` `  $ <}*` *  |*  ?2 <` " <"h<`bh @ 0 <` " <"<`bh㿘<~a   +<`#-<} b<}*` * "  |*  *  <3ᘘ # <<# #"F Mz< 8<^"`aܦ    aܒ`1J@aܠ  `  b*` * " *  <<瀊 b<3<!cL< " с <`"h`€@@  @H<`bh<}@"0㿘<` "*` * <}" *  <<瀊 b<3<!cL< " L <} ` b<} ` ` b<<" b!<`*` *  <}|"h*  ?2 €"h @ b<}*@ *` #|*`@R``' @#<#` b" *  <` !<3< #<!! b b * @(`@(`@@מ! ` b *` *  |*   @2 㿘#<` b<}*` *  |* `Sl  bi   <cD<#$*@?" b *@ *`@ * @ @"@ <} *`@ `< !<}< Ш#@ < b#xТ @ @ b * @(`@(`@@X0  * @(`@(`@@h㿘<` "* <}* "  `*  << "c<#p b<}*@ *`@ #|*`@  bɐ <~!@@ b * @(`@(`@@!<`"h @ "h @ b|* * @ *`@ R 4@ @ᘀ )!<~!@ @$`@ "#@ 0?*   < *@<8 D*`:`7 !ܒ $ " % b|*` *  !ܑ*  @R    <<^ "`  b , :   b@T *` * " *  <<瀊 c<3<!cL< " ђ 㿘!<` "<}*` * " *   << c<3<!cL< " ϴ <} ` <cD<#$*@"<} ` x` "<}*@ *` #|*`@R`??I "" *  <<瀊 c<3<!cL< "  !<`"h @"h @d" *  <<` %<3<#L<"  e "* * " *  <`< (W " * @(`@(`@@+ ` "*` * " *  <<耊 `p<3<!cL< " 4 "c|*` *  *   ? "<}*` *  |*   2 @㿘<` "< `%<  <} !< @  & @㿘<3!'<^<`<`"""Ho`<9#l2o  %<^<^" <"@4 $,`-<<#D  $* $ 2$ < #D<ξ < κ< 0w*@"   <]#䀢`<^ $ `?{<}`" <! /< '<}#<`   ! ``$<k! b ` @? 3#D!!<3 </`Hj  </ D D : @ :   `H<" ,   `" *  <b , @ `H?"@ *0 S0$*`@ ` "`K(㿘!<` "<}*` * " *  <<耊 a@<3<!cL< " % <"<^"`  "  @8㿘<` "<}*` * " *  <<耊 aX<3<!cL< "  !<`<cD<#$*2`` "h<!p"h`"h @㿘+<cD<#$** <a<^" " Ho`<9#l2M  %<^<^" <"@  $,`#D*  ` D  `  <} €`0 ` !<}@   `€ O cD*@  ` 㿘<̈́!<́!<~!<3<`a<`⠲ " a<" q!<P<l"<i" <cT /<-<`+<` @pq*   @pl*   @pf* M8<`" <C"H<`<>"`b <} !< @4"b & @,<D<c$*`@ !<<}`€  "<`T<"<^``<"<`#X `"<` <"<`#h `"<` <"<`" `"<` <" <a"" <a#<`"h<#<<ݐ#(<`P<ؐ#8֐㿘'<^$ EH/`<9cl2I %<^<^" <"@ $,`$ <<` "<̟#P<cD<#$*!<`"h@ " @ "h @<<̅#x@ <#㿘<~!<` b   <D<#$*`@ `  *  "#<} <3*` *  * c|< "L"  " <D<#$*`@ `  * #<}8 <`* b* " ,, #D:Z:` <}*` *"  * *c|  㿘<#D< *c$ 2  <5!   z<` "* * <}" `*  <`<# <~!@Y ℀  ℓ* @*`"@*`@ ` aa`G`  @   <  ͐ <`bh @ #D$*  %" #D$*`@` `2   ` P A ?#D*`@`, * "`< ˜ 㿘<cؐ? H!<` "<}* * " *  <`<#x "<}* @(`@(`c|@  @{/G㿘<`? <`P<``<`"P"h"\i #㿘[U[T<`bP  S (`<`"\0"\"P `< <"P  w<`#<`L"bhUQ?UM<#D<c$* 2   $"P"P ? ?$"P<`<`<` P"bh㿘<`"h @ 㿘<`"h @ 㿘<`"h`€<`<}((#|(<}<^P༐"43  `*` (" (>*P(3   ( (0 㿘<`"L`'<` <}*` *  |*   `2  I#<c !<~@! "@ ℓ*@ *`@c ` <}*@ *`" c *`@ *"`(@<`"h @ ℑ* * # c *`@`0 <<cD#$*@ "`4 <}c|*  ?2 2  ( <^(⬄<` ""2  <_,* <` 㿘r !<`  "h "h"h @"h` € "h @㿘+<`b<~ "# @<~"a `   C+ +  `< 2 8 M+ `c <` 2  ℔* `@ +  `<` 82 b`  `" + ` * 2 + ! ` * # + "+ ##  @m , @o  @o!ܐ@ `! @oAb ` !(  @ `***a *a !@$ * ܐ `!@l˒+  `` #+  `` @  ܢ `!@ܑ+ 㿘<`"<`<`? *d#"p<` "<}*` * " *  <<逊 `8<3<!cL< " q 㿘6   @  2R?. 2 1<`"-<` "<}*` * " *   ` `@  82  *  `#  * @n " `2@@C?0<"`"`<`"<c<`<"h< ## #Ȓ ?"?@(㿘<`""L<?`P+<#Ԁ<` "<逦 %<` <`* @*`@!<}#|*`@@R` I <`*@ *`@ –*`@2`@ 2`Ho`<]b8j2b "' Ԁ "$"8  "8Ԑ  " " "@ $"# @ ""` "8Ԁ ""8 @:Ԑ"8*`"c Ԁ*   "  `" "` " " ` M"`" Ic Ԁ`E< | `0@ '<` <~* *a <}   * c|*   "`"` ℚc|*@ *` ԑ*  *` @"`"` Ho`!<]"8l2 1 ,`㿘<} `<` "*` *  <}|*   `<~<3!" <~!ܲ # *@ `  2 :`   /<@m." a+<`  ! $@m&"  " #" * : @kÐb I@k?*< a< `"  a< `!  a<   <Ӑ a< $< H!˖< Iǐ!( I %b!%b " b  #<`.bL+#<`<` &#<`!<`"h @"h @b <`<`"h`€|<_b",*" *  <~#*2" #<`bL &<}*@ *`"@  *`@ `<!<`"  <r!@<_"",*" *  <~#*2" $bLa   !<`< p`  <!<`"h @ "h@!<` #H<`<`"|"p"t $"|!<`"h @<p(`  ( `<`<``$"`: 㿘!< #H@<`b@l{@ly #H&& <`""㿘<j  5<``/<ߐ<`"`<~! ` # H | L" $∤#ԣ* `<` '<~! ``2"|<` "<Ր!p<ѐ!<͐!<Ȑ!<Ð!<ƿ"<"ƻ|#`<`"x<` H&|"@ b`*`    ( `]* %<`)<+<<`bd`*    #a" : Ǝ"( HbXxƉ!<~<ƅ!! ` 2 `<|"x! ` -<t"*`< "l<~! ``@l@@l@` < < Q"` ` $`<` <` "<C"㿘<~ `  `* #` ": $ ?@ <#) 0*$㿘!<#  2` ` @ <~ #!! +`<~` "!<`‒ #!  2 8 ?怢` <` "<#(0<`‒ #!  2 8 ?+`•%<@k`Ԩ`@j^, `Ԓ@k? ,H`  @   <` "bհ  cH@jB, ! 2<` "<}*` *  * | `" cH *   ? @  @j* cH !<` ԰ `" $"ܐ  *`# ` 82 `ܐ "*# `ܐ C* `  ?    2 `# * `#   *`&<`ܴ   `* "@ ! ` "2` *  * `* %` #* 2 *$‛+@ `cH;`@j #* 2  , "‒@j$@6 $`* $cH@j@ `"?*`"%< <~!ܱ>  #@?*#`!ܢ@ " *" `$ *`$ cH@ji@(@ܒ@j !? @   2 `!<`"L`%<  `! %< `  cH @j@@j>`<`,I @ bp$ <`"t@  I<`"x <`"|  I  ܒ   I  ܠ `:!`  ` ܐ `cH .  * ‒ `"  2 8 ?[*?X<`"d*ccHK"  Ԫ` 82 @8TcH $, ,`@#<+  * <} *  ` `,<`"L` <}#|*K`=R:@`㜐 ` <`bܑ*  "D"<=#X<cH#6?  ` "<``@!<`p &9<`"t@2""|cH4<`bx   I <` ` <`<`bd*   @  <`?<`<`"p$"t"x'"|<`<`"x `% * @#  I  <`bp?<`<#<`ܐ"d@*<`"p<`"x$"tŔ  <`<`"d* "<`? I  ?  ܙ* *` (" `   2 ; "| <`bx< ` `#@f*  ܀∀@<#Ì−`   b`<" ∐ 0~:` cH<w H< `# hq< `" `! `h ` "t<d <`p<_ <`x<Z <"|V 0_ ` @1b`@ <`"d@* @(D<A <``<cH: bx8!(<4! ` 2 `<+"x ` 0 <""+  *`  (* <!X6<!<!:` <! ` 0<#X 㿘<` "<3<` "bh < p ""<^<^'<`T!<^<~"!܀`$ < Ӑ" < ̐#<`<`"bP"<`"bh$T0& <}<`#+<~ Ԁ`2$`#<`bT!<^%a܀ $ < ®" < §#<`?<`"P"<`"bh$bT@ <`"X #02  "`(<S!Ѐ "    2 <I! 4   냐@<b 雐?, 4 <~<%a""X  :*  2@ `<* <}*   * | ` <" S 0<`b - <`bL  Y3   < @"X$",  |* *  *`@ " R`*  >*R <^*`" * ⬐  $bL$"<`""L < "c  Z Ԕ|*` *  *  `"<<# <*` * " *  <` <cL<! "  㿘<`c<`<"h"X㿘<`"l`<`!<# <ِ" <"0"T` <֐"0?<ΐ#㿘!<` "<}(* "`*  <<~<`#<~<`""bh#!*`"@<# "<}* @(`@(`c|@  @q[<@!??㿘<#H㿘깒 " `< <D#$*`@ ` "`D#$*   2``<`c<`"h<"??o㿘  <~<~!@  n"<} *`. `.  *`.!ܖ . #<`<} ! @  /* !ܖ .!!`!ܑH/`<9cj@2 @!"*@ !@  `. @ `/ @"@k b !@ @ ?"@!` " f b! @" @A $$!ѐ㿘`&`  ?`2 ?2  `, $`` ( 2`㿐<cD< * $  2` <`0*@ "<` "<}c|#D#`   : @ 2   *`@ `  "` 2*` 4#D$*   2``?0$0*  "i?g?' P   "]?&<; @  @n P  P  ? H $ !$ ٢`P > /*? 6*$ D $   ɐ?2 ?2  `ϐ $  $  !    < @ @nM    ?  !  C,  w<`c<`<~"h<"ܒ #<` b + @ *`<}"@ *`@ `<<#p ? #D$*   2``2? "<}*` *  |*  ? =2 %;<@@m P  P  ? +  !`P `"    4 @   <  @mԐ    ?   2< "㿘6   @<^ ` ( @oM. .;6  㿘` .`"<^* b &諒 2?  ??{<_",.  & ? (*]@'L^@$40T@ !! `?<;   ? ?,ԑ2 ݰ ,Ȼ2 <@  ;@Ұ?&0L  4   @  p2L!<` "< # "<#bZ'LLa X@  c`@e?zb@&c@8?qg ; / /'7< @l     }?T@ !! `&W<*2 c0* g"@<; b?*<ڑ2 c0* @&0XT@ !! `2*J?/ *1 0C =<; 7?&01<#$? @")?<`#L    @2`: : @  ` ?ꀦ L`@`"?` "?`<3!8`   ` !!` X? X@fL`L  <;  @lP  ? L"@"(`8bJ@.bF@. bA@bE@?0bG@bI@ݰ?0bV@"c. bK@ӐbT@N?0bY@zbX@b?0bZ@??0 b@$"@f "@"@??0z"@)b@?0q "L@. "@ "H@?0a bB@ FbC@A "@ٰ?0T.* <}c|*   I?̒  C?r @mO @mJȐ淒  .?.@*`@<}<~#|.*` <_@" b,#@ ,Q"`   .* "<}`*    :@ 쀊?ꀤ`mT@ !! `v  ?<}|<^ ` * ,`,` :  2 ?   @l?4#<^* b# "`"`"`"` "`"`<#"@<~.  2 @ $"b"@?`  <}#| &?:  2 ?? "?+"? 4   ?@  @??."<~* b0<` "t$@& & & & & & `!<`"|$"|@<~`.<_ 2`",C"@  #<` "<}*` *  * | ?<` "<}*` *  * |  "  "|*` *  * $"0 *`@ S  ,S  ,2 & "  L0.* "<}`*  < * <* "<}`*  < * <兒  ?  @?ّ.* <}c|* Q@  ?? .* <}c|*   ٰ?,2 ӰV  Ͱ?,2 Ȱ* "<}`*  " 8.* "<}* ~`* "<}* `"@ " """ ,`"@.* "<}`*   T ("@<^*`"@ <#h@d%' 3j'.* "<}`*  @b Xr .* "<}* 2`  e?  @?_?.* <}* c| O6<*`#$@3'@<~*`!@@cw ? .<~* a "'`4丒  /?,"2 L?"%?0䨒  ?  |\?L2   <; @i    㿘<}J@   * <} h -<^+<]1<L * * " * ( c `X*@  %c@W (( <뀥  @< H < `@aX X`X`ҤX < !㿘  `*2  ` ) , @*`@<}*`#|@2??_㿘 <} |*2`  `@ *` *  * @T   4 )*@  ?"?@B * 2` @ T   4 =Ж㿘 *`2`  ` @`  @o . * <}* c|   ??& <` "< p& @ 㿘`2  *<` "?< 022  @4,?<]c:  < : * c$  * 2 2   ,?<}*  c|*   ` $ 2?*`* c|  #<}`*  <    @j  @i* * c|  ? `$(2ְ?@ "`$ϰ?( * * c| ? " * * c|  `" <`b` R * "<}*   ``  @, ?2 ?2  ` b`  < H , ?2 ?2  `w  b`  <` "<֐ i  , ?2 ?2  `'  ?<`<`<`""x$b`"bd"|* * c| + ?" $ +<`"t@"<`?"bp"* 2 - `   H  ` 6``  6`=$*  2` 2`$0*@  "`$ @2( ` , , c|" ((' *`?` * * c| 2 ? 㿘6 .  2  @<` " <F!0<, * <}*`#|@ 1@ 2/ "<} <3* (P"@ 6 @ ] e 5@ 2  2 <^` 2 2   |  <_",,   㿐6  `  , <}*  * c| %<^ )<_   2  ",,  2 |  ,  @*`@*`|@    ,  2  ",``|԰ 0Z* <`t|*  3 3 <`?"bp (  @h  @h",  # ",`0 `* 2 2  )<_"L*` "$,` ,ؑ2  ' 0`   m` (z    -  @z 㿘Bm!<`A"l  $"lB[ B}ޥ <<` "<]<I"h"l$"lH?"#DcD  "cD<#$<}` $#D#D*   #D #D*  €`#D  &#D?$#D < <c$<}` $#D#D* @?#D   €`#D  $#D <]"#$#D 㿘BAQ<`bl? "blB0RB#<]c  !<^ <^" <"@6 $ $c?  #<`<```%<`'<`!<<`"d* ?<`<`""x `#"d"|2 2` b <#P<#h <#(X `<#P#D$#DcD  "cD$#D㿘<a"x`0   Đ?m20ᢀ20ᵀ2 0⋀2 0茀2 0鮀2 0검2 02 0 2 @0Cwhwx$vvx$x$x$x$x$x$w$㿘<#`p<p  0-$`p㿘< `G`2  "`(<#x " <  2<<# ` <``* c* @*  ``<# <`2`(` @^ 0 @`@f˞`( +  <㿘 "u? * p7!` j < *` €T@ !! `"X? **2 S P?<; <#+  2` &0B@?<; < x+  &032?T@ !! `2<#?;   ? " *?6 0*2 <@  ;@?&0?㿘<b<""@ "@ 8 2< ;@  @d@B >㿘<ab|? "b|<< b    "&0 $b +<<a ?|<a" |"` ?  (\'H''L'P'T@^ DH*`  " H  !$7  `   , `" *   ,``"8 $ *,     / ,`  "  '' "@`  ,  *`#`" H`@*  '?'h ʬ .'@" .`_H ;<.` @ `&+` " ?" `@*8 +''''@*  ` @h a 'a!  h"`"  //'*& 4@, ""4H*`&  / c/L    /7LT" *  /L" P* 74@)  , * ""  ) @)@4 @2@)@? @  $*.`? @ I;.  `@ 㿘 ?@  ? 㿐<bd/ '/` <a<<'H ! 'c'D3<!<a#<a#c@`` *@ $#@d * # D*  @`+@<b d`c $4+<a-<ac@`` *@ %c@< * c,`  *` `۠ `$4<  *@  @8& `,`+<a-<ac@`` *@ %c@ * c<b`d$   4!<a#<a#c@`` *@ $#@ * # H*  @`-@<b d`c2 ~ $4+<a/<ac@`` *@ %c@ * c,`  *` `٠ ,`$45<+<a1<ac#@`` *@ %c@ * c<b`d  %" $4+ %@%@@% %@Y < @*@  @|& ܠ 耤<<&"!"a  㿘<! <<a a&#  4#<a)<a'<c#@` *@ $c@3 *  c?# ? 4 '<a+<a)<c@ ` *@ $@ *  ?#*@5 4 -?/< #<a+<a)<cc@ ` *@ $c@ *  c * @&c 4 ذ?& &c& xtp "? 6"  .   "@! ! .  !"@!   .  !"@ #\'p<a<ap#! ! (lh .   " #\'h<a<b (   tt0 lph  t l㺐<<a !%<a)<a'<#@` *@@ $@\ *@   `?! 4`%<a)<a'<#@` *@@ $@? *@   `?  4`%<a)<a'<#@` *@@ $@" *@   ` 4`T?Q (<a#$ *%<a+<a)<c@ ` *@@ $@ *@  @ `*`% 4` ޠ? <a#$**`"  '#\       0<b d*`  /< @%<a'<a@` *@@ $@ *@   @* @' `$ 4@ `.  % /  `%<a'<a@` *@@ $@ *@   `` 4`?`f. "@ ]/   `%<a'<a@` *@@ $@R *@   `` 4`?`6 . "@ -  `%<a'<a@` *@@ $@& *@   ``  4`W?`   . "@   Kt<b`<a<"a<"a '<a#\p# !  1<@5"Z0+<b '#\.<a<b (   <@"A?0D   3 10 㿘<<! a  %<a)<a'<#@` *@@ $@ *@  `?& 4`%<a)<a'<#@` *@@ $@ *@   `4`?%a %    $ 㿐<<a< "!""a  #<@X$a @S0@Pa8 !  <a? ""a @X <b  <  * @ "*@ !#! !   * 0 8  #@ 㿐<a<a c <  @ $c@/c<  @ $c@/c<  @ $c@ <  <[#*`:  <T#(c<  @ $c@ <B#H <=#` <7#xc@`$c@c@`$c@c@`$c@c@`$c@c@`$c@c@`$c@  1 c<  @ $c@oc <  @ * $c@`* ? ? c@`$c@P??c !<c  $c@< c c!<  $c@* c  "<  <0 " < <#<##@Q#?c<  @ $c@c <  @ * $c@* c <  @ * $c@* c <  @ * $c@* c<  @ $c@c <  @ * $c@* c <  @ * $c@* c<  @ * $c@* <b`8<  <a# <  0@?㿘 KV  2 !!` < )l <)l !)p !)h !!$;!(c +&!$$ ! "$!()l!( !)h!( !)p!( a@^GV  ! @^?!2  V  "   @* !(㿘!( !  )h `@)hm !)pj !! @^㿘!(  !$ `e U!@ @]2!\14(`<; @\U@@2 `"*?)@@ @` @&  @ @`Àh @] @@4  㿘!("  !$ 6 @ 㿘!(   ܀` @T  '  ! R ;<    ?#㿘<;@ @?򀠠?!@@]W @@]l 㿘 <  ?  =А㿘 <l ? ې 㿘!(  ؀`"!$@!$@ )l!%`.!%Y !)pV !㿘 (?!($!V "@`*` `! &)?!   @]`0 ! @\ݞ  ! !`"`oʋ@\ @㿘<b `  <"( %< 0@I @o$ &@@ $@㿀<b `  +@ &` @  @2`  Ѐ@2!`<b8 @IYԯ` @ @  В` @  @2`  Ѐ@"?`  &`  €? F?B<b`    2  Ѐ2,?2< @ :`  `82`6"?`?  <:`" ` ( *  "  "  ` @`2 ?` `> "`  "`@<☕:  (*@(  Ș(<ȘPȘȘt(ȘȘȘȘȘȘȘȘttȘǠǴȘȘȘȘȘȘȘȘȘȘȘ,ȘȘȘȘȘȘȘȘȘltdϬ Ϥ@<|<|\<Tl\\\\\\\\\(\\\\X\\\|\\\\\D\\\P\߸(|\<\\\\\\\\\\\\\\\\\\\@$\\\\\ۘP\\ۤ\\\\ی\\\\\\\\\\\\\(\\\\\,߈P0dPpXptth㿘@ &?<ި!. `<@:8a 2  ` @ ) @PP @@@PK&$@@PE@Qd@P=`* ` @P82 ??`&4?? 㿘@ &?<ަ!. `3@1/a 2  ` @   @P @@P &* "@@O@@P4 ?? &4@??`㿐<ަ!.  L &@4 @P@O2  ?<ެ#a. @ @ &#?<ި#a@ @@ ( @  $@ `: @@  ` 2@@  $@ @ :` @ @` L      㿘<ސ!.  @  @B@e㿘<ޘ!+   @ ` `? " ` 2 , *    @  ! @`  2 . @ `w   2 " ထ+ `$".  㿘!<ޣ. !3 3  ` `@ 3 3 3   `   *` 22  ` *  2`&㿘6 : <ޗ.   ` <ޕ. a    H  € !`D >!"6!(3 -!$!%!8 .2`  * 3 !"  '2`  * 3 !@ 㿘<b!\<b`<2!.    <b <b d`@!b<6$a\. !   `H €!$a\ "<b 2`6a >` @Nz#<b4ab@M<b`* - 3!dab 2`2㿐<ޤ!.  .`* ," *`" @  @2@ @ :@. @.`2& 2 ` ;"` ', " 0"#\`   `&2 *`` `, & 02*`㿐<ޚ!. @ ``," ` .` 2 `". @.`&2` 2` ;"` (, 0" "#\`   `&2 *``` `"  & 02*`㿘<ޘ!.  @* 00<?+?c0 "@  @ 0 @ "@ @3` ' g@"g!.   2@   ` 0  ,㿘<b"t !<@~"". ?#<ޖa `2a 2 ? ` 0" ,?$"a@ € 㿘<b!< (<b!,`$<ܐ"С.  `<ޢ!@ ` <b"t @@}@    `€ 0㿘<ޢ,`!@@ 2 ,`` 8",`€ ,`  ""`` "` 0@L   ,*` $ 㿘<b!h` @ `<#8x 0u2$h!<b!<c!<-<ބ. ! a    ",` <@ "  <`@ " 4<ޤ!,` $@@  <ܐ" `\2=`"$hH`</ Pj26 <:!T@ #!T*@$h> <ބ(@ 㿘<b<! . a @<a" @`"@@" @<b2@@!L"@"@"@2 $@2"@ ="@ €@`"  . `"#(2`".  `"2`( * "   @K $ 㿘 ><:?. ! 3!(>  <,?"Аa %@ $!@2@XL % 2 !(%@$?"` `@" @;  㾈<b!<'P` <ސ!,  /`<ސ!, @KxP1<ި!,@L  ,`@`@$ْ  2$ . "? .Ȱ?P נ P ',`' <ޤ!`"`` `" "` " &@ @ "@K`@L*5 &2    <ޔဒ% 2` &2<ޠ!` @`ƒ<"`@"""`4"80@],@Ő & @M{<ސ!` 7`* 7!2  !*2   !  ʔ 6666<ޒa@!@2 P L 㿘^ <ޢ!. @ @@ @ \ "$@@V!($@㿘` <<ޗ.   "`, . !@ `@  ?"`,"`,a@2  "84  a "`0a"0a"`0a@ @J+ 0  ,*` $ @` ;"`㿘<ސ!.  2  4 <b <<ބ( 2`<bT  THo`</Ph2<:!T"!T(`<b <<ބ( 2`<bT THo`</Ph2<:!T"!T(`㿘<ޚ!. @ `0`82``4:  !?: !"`0@   @ " !.   ;"㿘<ޘ!.  04@`8a  !"0 `` " "`!.   ;"㿘`0<``<0vK<0s.   a ` ` " S2    , `   0@#   0   ` " =!. !   " @2  -  `    @ 0 ` `,   @ 0!. a     @I!@   `  @ !,2 ??`&2??! {"㿘`<``0W-<0T.   a `,` `6"   `   0.   a `,@ `*""` `   0 @aမ.   a `, `* ` " `   0 @a.`2`&2 a {"㿘`" <ޖ. !    ,"@ 8 + 2 ? &? 2@??`a 2 `  `  ,@ 0` ;"`<ޖထ*   ( # *@" (# ( "(㿘<ސပ.   `@ߢ  ,`D@ `1 <(!p*` €ːġ. . a  `. a n . a  . a . a   ". a@`` ` `@Rla@"`@ * # @`* "`@R[ . a "` ` #` `* x"`@RH . a "`    #  `e"`. a  * @ "Z . a  . a . a  * G". a    `  * ` 7"`. a@    `  *@ `* '"`. a    `  *. a@ D@ •<b !p  `؀ <b!p * ` + န `@&M㿘N<b</<:T  P#T(L#P(#LN04 @QH`1<!Pn2=aP#0"aP.Ho`Pn2+T"T.`p<ސ!. <c`02  4,@>p㿐` !!**+ <c::; @>\<b<<ޑ* 2  㿘<ޖ!.    @@ `@ <޻* *`@*`*`*`*`*`*`*   j,`D "I "% `.   0. ~ "E  7 D#G. s  2` a  `e *b"2 ]*" `  dQ. *" Q G. *B"` 2` 1  `5 3"@*." *"D "   . !  `. *"*"  2`  *  `@* ` *`.  ``@@(g 㿘<ޘ. ! D` <("8*` €!.  "H`<b!p *  2  0%!.  "H`<b!p *! 2  }0!.  `*` $! 2 *q0i. ! H`<8 <*` * " * " * <b"a4@ CX!.  `@"`HN"`L"`!.   @   H'8 @E =& ;& !.  H 4{? /<b`H?"DH`</ Pj2 <:T`"T*0. ! H`<8 <*` * " * " * <b"a8㿘!<ޣ* ! 05 8` ;"`㿘!<ޣ* ! 0 8` ;"`㿘<ސ!.  ," @`" 㿘<ސ!.  0" @`" 㿘<ސ!.  ," @`" H㿘<ސ!.  0" @`" 㿘7<޶ေ. 5`,9 ;`0&`0((#`0((&`0(( @& 0(( ' `0( (@&`(`.`(㿘!<ޤ. !M  2 * * @# `2` *@ * #` 2` *@ *  `2` *@ * #`2`*@ * " `*` * `*`` 6 ` `@Nڒ. @"`W@` ;"`㿘#<ޡ. a@" 4@  # 8@"<@ @N"@ "`@ * @*`@* "@`) ;"`@+@' >"@<#@ ?"@ *`@ * "@`*"`@*"@`*"`@"@`"`@*" 2`  *  `@ `,*+  ? *` ǐ ,H`</ Pj2  <:!T@ #!T*@ "`@(z2"ɐ@@@!# @!""""@""`@ " h А`K 㿘 x<2< ߀!.`8<0\< !<l"!<<! `<c#€0!.` `, `?"` `,?"`, =!.` , *`" "  ``,?"`,`,2`* @ ( "  , *` }" <ސ#@.`@ `s<ޘ!.` ,* "@" ", ;e"!.`  "@M "` R"!.` *"@M "* ?"!.` :"<!.`  4"<!.`  ."<.`!  <?` "<) |*` €!݀@"`<<(#x. €! "<!  "<! "<!@ , *`" # @", {"0/00! ,2`ਕ* `+  " ! "<! "<! "<A 0<ޒc@@ ` *`<ޔ@@ 2`  *  `@*P!R!" @`@  @  `@`D* "@@ @ "@@ `@ (@ ! "`@" <!@ !Ѐ    !!9`@`D*  "`@ߐ?" " !@ vDH*` * *   `O` @ * P*`* W @@ +@ X*`* _ @ @+I!" @`@  @  `@`D* "@@ @ "@@ `@ (@ ! " @["`< *"`<?`?* w@" h; А!`@  "`@Ѐ !@D* *` * " `@`D*@ ?А"@ ! "<! L"`<<(#H* € 0 0!h"9D  HL* *` ""! h$!@ D "(FJ* @2"2"! h D  <ː#pr0!`( 7"``5<("p*` €!`D ?"`D0D0!`D 2 "`D0D,# 0y!`D 2 "`D0D,ݔ 0i!`D 2 "`D,D0͒ 0Y!`D 2 "`D,D0# 0I!`D 2 "`DD 0 09!`D 2 "`DD 0" 0)!`D ?"`DD,0!`D ?"`D`H ?"`HDH0 !Da0!Dܐ0!D0!D0!D0!`D<#xX0! D` ` , 2`* ` * *# " " " " " Q0Đ!`D<ސ#@@  @hԔ!`D 2`H "`D`H 2`"`H`D`H `"`4H "8L 0o00!Dɐ0!D070!@@ " <G8 !0t!0q@` ?m"`` h"!8c" <!?`&#  E2`& & @` 2&820L0B! U!*`K! 2!! *!` &)" `0B! U!*`K! 2!! *!` 6 `@JF"`" <!"`<㿀'D)?'H '  <b@   <"@# H " <<;  ? Ұ <ޓ-!@   7 $ 7!7<b!< hHo`!</ Pm2 #<:aX%< ?$aX @I-`#zDa$ ih`Ho`n2 @I<:X "X.`H " `'Ho`n2`<:X ?"X @I.`#+<ޖ! S $O*    ?*  " `?*` ` 2D`C  @ *`@ "  @ *`@ "  @ *`@ "  @ *`@ " 2 @@ *`@ "*  2   * , @`!  @ <ޑ2  =!@?#: <ހ  @`2   2 <ޤa< ~`z@K ?@Kc"怬@ yD@   `  `&@ 0:@?<ޠ!$ ,*"@ "", {"`2  : *2  ` `a* *  `   `* 2@a 2<ހ`6<  ,<ޖ!,?@ `2  d ; "` ",` "`` &@@ `: 0@?DSDa$ ` <ޒ@&@ :` 0@Ho`</ Pl2 <؂` @Hs<:X "X,`㿘<bP#<b %<b$'<bHo`<!Pj2 P"P*`  aD  €"` 2 aD`(!<b!<@ ? ?p!<@DCaD?$aD( T@$(T <b@!<<ܡ, " `2 $T<ޒa@ 4T$T㿘<b<b!$ a<ޮ <b"D @Hն!<b!H " <D? "<!H?<ޓ-! . 6 <<#.D" `D<2| @  `  -@ d"Q@-2  !@a 2 @ ` 0@ ,@ ,@" ,@`$ `,?"`,  !`, "`?"``,?"`, ;" .0 "@4@ ,* "@"@", ;"@`.` "@ ,`* @2@3 `?`$"``` "`2@-2  !@a 2 @ ` 0@ ,@ ,@" ,@`,`"`,@`$"`@D @GVR " "$<b>(0㿘V  2w?Ѐ<3!8`   ` !!`"d?<;@  @` ?`2U??* : ` N<) *` €@Ҕ D@@@ 0<@9<b ".@03a.@0.@ɐ+ <3!8`   ` !!`2<?`  ``?` ?* : <b"aH <b!<?㿘4@㿐/ ( !$ @? 㿘) !א 㿘 .!V " ﻐ &<ސ#@.  2`  *  `ǒ@*H`</ Pj2 <:!T@ #!T*㿘 )!V "  !<ޕ. c@  *H`</ Pj2 <:!T@ #!T*㿘){@㿘V !"@𢡄 "<"З,  "@ !` &)<ސ! ` 6! `6! !"")㿘'<ޣ. " ."`"  @;K $ p@A"<b<b<ba" `  ? @ * `*@  * ` *` *  <+ !""`<ޗ*  $0   8@ &@ 2@`㿘 o? <b"! @?<<!a .``1$`".`a <`@` `€4  뭐 `2 "!@2` `@ˤ< H `< ``~`<ޓ-`! < p" < 0< 8  e0< `<  > " <`; `((8<b 0 0㿘<b!<<<b!0a*@  `(€ 0  `(€ 㿘<9H<? ?c<"H"܁㿘<b<b!,a<l <<ޢ!, @ <`"@@ @ (€?<`;$,0P, " `  G$,א<b!8<3!<9cH<<?a"" #" #cH<9H<? ?c<"H"<ް! <`"@  (€ < `$,<b!X`<b@   <b!0` (€`㿘!<b!, 6#<ba< <ba<< `0*!4<<@ b؀  "`<9<3H!@ #b"H<b!X$!,`a<@ @A<ޒa, @  (€ a< a<㿘N <b<<9H<ܒ ?Ї("H <b, <3<<?" `"" "H<b4<3` < "H㿘<ܐ"б.  ` <ޒa@ <b0ap㿘<b!<b<ba" ;`  `)< @   @  `#< @    ` `#< @    ` `#< @<   @*@ @  *@ @  *@ `  `/<b!<b<ba" Ð   <ް! , `   *  @`*@  * ` m > 㿘u 㿘o 㿘<b<b<bနb<ނ!. `  @  * @  `*@ @    *  6㿀<ܐ"С-? `'@   @9 @ N ```"` 20``  ?  :;@@<  `?`ې      ` ΰ?&` ?` ɀ ` Đ`2 @80*`@?   <ޒa@ ,€ `   `? `<;   @A ?&`Ho`</ Pl@2. @%<:X!<!ؐ ? $X @BZ,@`<ޒa-@  ,€Ho`l@2 @ @BOX $X,@` E&``C `` *`@72 `` `8?` 耢@` @` ? ` @8?䀢`  ?䀦    <;   @@   ? ]㿘<ޠ!.   H   . !@$  !㿘 .`<ސ!*` <ސ!*`  H €<ޔ* /*@3*`㿘N`N@<ބ* @2 @<─ @㿘<6!.   ?<"b铐2 0ŀ2020%20タ20Ѐ2 0]2 0퀐2 0R20v202 02 02 02 012 @0̀2 @0㿘<bt<ޒa* @ K* @A"2` 㿘#<bbt0?!<b"x? <" "xbt" 籔?$"x㿘< <b;b ? @?   " 㿘<b!<C <; <  ? ɐ      @ @   @  @   @  @   *` *`2      <ޓ,`!@  + *2 ?   *`?*+`2`2   *`(2 2` , 2 *`2` * 4 @5@-   @5,` G 0N   B <b"t< ,<%"t?0)^l?0$/<bk7<  `?/<b 7< @5    2 <bℒ ` 2ܐ  <b<ް`?"a  `@5ʐ . Ő % 22  `@ 22"t/<b` @5&@5@$?7<"t "tޒ?@9 ` @3? @3:` ` `' !<޴!`| `  @3  @3`    "`e "x?&@"tx2✀@ j &@ "t`"@"t `@x x"t"  0x "t$ 0 B&@"t %xx&✐&@2  :  Z  <b< *?01"  x$✀ <ޢ!* :`.@` `@  @4  ✀ .@`✀<b&@ "b|㿐) ''H`<9#D@>h`   '$ $D<b"`-<bb| (  !!`|{" @" @"" @ @" |ݐ H`D@>h` `2"`$D! &'''''P' '('0'@'l'l'l'l'l&&㿘<b~ΐ" 㿘. 4  '@%H 4 4 @   ?@ 0 @ 4  ?@  ?@ 㿘@m㿘@{㿐@? ?<b "a( H`</ Pj2 <:T`"T* @.  <"<b b<ba<*  <b" a<) "$a<<b<ޒc@*  `  `?  "쀤  .`: @@L .` <b2"(`<b  @( *@>H @ <b0"(` <b@*@@>@ * c<.``?<z"""`.` s<b#`o<vc8 @ <@0f ` @2L".`: @_ L"逢  `TQ ` <b|@ F<b<h" @@ +`6* @+`2 &2 ` : )    * `2@ <b",  .` `€:`  * .`  `ܐ0@㿘<b"{ڒ #<bbJT! bP "T*@L`"P* "Lb<b04 @=qH/`<aPj@2 @aP"0#aP*@ H`</ Pj2u <:T`"T*㿘<b"{ #<bb T N<b </!<:"T!  P "T*@L`"P* "LN b 04@=H/`<aPj@20 @aP"0#aP*@ H`Pj@2 @!T $!T*@㿘<b.`#` [ O*`* 㿘!<b "耢 9,"6 <b" `. <bH造 <b 0(dž* <bH造 <b 0(dž* 㿘< 㿘<bJ"逢`<b"` a$ @ 0@̐ 㿘<b" ` P 0@<bH造 <b 0(dž* <b@<b DHo`</Ph2<:!T"!T(`㿘<b!<)<b%</'<:a< ?" >m "?%!DH`Pj@2[ @T $T*@㿘<b!<`)<b%</'<:a< ?" A " %!DH`Pj@23 @T $T*@㿘<bb`KaTbaP&aT .aL &aP(&aLb<b04 @;˞H`1<!Pn2aP#0"aP.Ho`</Ph21<:!T&!T(`㿘  㿘 㿘<b  ܝ㿘!<  <!| q  2$ 㿘<b@fb<b@7a<㿘@j㿘.`` <b" ` @<b<b#4* €㿘<!㿘.``3<bb耢 <b@+ <bb܀ .b"b 㿘<bc @.`@:`㿘.`` <b b耢 b@ .@.@㿘<b<k b !h *b<j"h    `     Y *`` <b DHo`</Ph2<:!T"!T(`㿘.``  <i"h*` }㿘.``L<b" `<b "` b<b# J Ē 0:b ` ) &. <E! €           @ 0  0b G 2` `0<b#J@ b `ؐ 㿘.`` <b<b" c J 2`z `㿘<b<bJ" bM  *.`  <b"  `**  <b b   +<b    *  b `b *@#b **@#bb<b""<b"  ``M ?t ?&"㿘<b<b  (  ((<b . ) <h<b<b. "<  >`(@`.`6 `@82 ? " @+/@?>`" Ӆ. 㿘.``<b" `  "  0 㿘.```  ? 1<b"䀢?`@.` &"*`` <bH造<b  ( **`` <bH造<b  ( * <b2 <( ?@?* Ho`</Ph2<:T"T(`<ޑ* @`*`<" (  "  `?"`+  ?+ 㿘<b<<ސ#@*`@ ` `@2 <- " ``( < b` 6 `@   `` 6 `` @ " ` 6  ``@ "  <b ` *@쳐<b"`@2 0Y2 @0s2 02 @0ˀ2 @0݀20w2 @02 @0Ȁ202020݀20X22222222223H3H3H3H3H3H3H3H3H3H3H3H3H3H3H3H3H3H3H3H3H3H3H3H3H3H3H3H3H3H3H3H3H3H3H3H3H3H3H3H13H3H23H3H3H3 3H13$23H22x3H12<22P4d4l4l4l4l4d4l4l4l4l4l4l4l4l4l4l4l4l4l4d4l4l4l4l4l4l4l4l4l4l4d4d4l4l4l4l4l4l4l4l4l4l4l4l4l4l4l4l4l4l4l4l4l4l4l4l4l4l4l4l4l4l4d4d4d4d4d4d4d㿘<H   4 <.  #  ``" 4&p ``2$ `m 42 `㿘<:  <$`2"P?Ѐ`Ew <K"* €"$`< `?."`$`<"<b@ ΐ<b@3a<t$`< " m$`1<b# "h$`<"#@`$`<" <" <"c Q$`<"Ѐ`"K$`ِG$`<"A@$`<ِ"TW9$` <#В2$`<ː#   <Ő#0  <#@  _ $`<#`"<<#h<#p<bc "<<#x<#$`<A0 ?<  " " " 2  2  2 * 2 ?D <K(  㿐<`#<#<#. 2 [`:4 2` <P#05 <J 0/o` ` '`  <6 0`  s ,_@`;&` <` "` <% 0 <! (0F< 㿘0  !0<3 j2@ <cԐ `?`"ci<B  " L L  "0q 2  L* 2 2   u L 0? !0<3 *<ѐ 82 0㿘  <V !`H "  @#W0< P P.@ .` .` .` .` .` .` .` .`㿘<A#0`  `X"`@`2`XV  2!V  2 !!( "!! 2`!2!  !< !z㿘 ?ꀢ`!<ܣ. #̐@@, @ @  $"@<ܓ. #̐@@.B @ ` <ܦ#̤ .`  <``@"7 2 W?ꀢR   @@,z @ Ԁ`"@@@@,m @!*` Ѐ` @ 6* Ȓ@,^ @! *` Ѐ`" ȟ@ 6 Ȓ@,N @!*` Ѐ`" ȟ@ 6  !<!x1@"  `"@<b * 2 P2 P & P@62P 㿘Ѐ !`4d<!8  @/     d ?d j > ?  ?? ] ????㿘  0  !0<3 j2  <a`א<Ac0)h )l)p+<7')<H<b<b#c X2  "  " *$%2  2 ?@p $  2 XW ؀`" @ `"!@!  `@ZsA !s> !s; ! D < !" $" (" ,"  0" 4" 8" <" @" <ܠ#  @ Ԁ`"@ @+E @!*` Ѐ` @ <!p H/`c$@4dh`  `$" l 2" p   j  j ! 4$ h"Ѐ"$" 4 2! H/`c$@4:h` &!?&!&! `.!% h  h€?2 h 0 `"0@0? !0<3 *㿘t<3x @4EH`1<!Pn2 aL#t"aL.㿘Ԑ <b`?㿘Ѐ  h U ihi 0M!T  `ސ`  i 2!h i !h?$!$! H/`<7c$@3h` <H4   ll@""4 2lH/`#$@3h` 㿘<:  @㿘!$  !(&!$$@" !%l ``.!%q !!( !q)p `@㿘!$(  , !(*&!$$@ l!% ``.!%qȒ !!( !qĐ)p `"!@!  )h `@)hq !)pq !㿘 " :?< a X*<b#   @ <b#*2 y  2?"? "? ? <#$0㿘? *% $` `<b#` X<*!<b#   @ <b#*2 W)  r?ol k g䀢`20a   `L  @2  @2   @2 ?>2  Ā o-8Ā  `@@ >`< c"4 @2V u @2e u㿘<c`8 @2W o㿘<c`8 @24 k㿐. 'H2   )?T` "@ې`P/ 2     '􀤠 @-k@ C 4@(`T@@ $  ۀ`&@` &``$&``(&` `,&``0&``4&``8&``<&` `X@  @ $  @*' $T` 2g`P В @-)`@ `L`   *`@ 5a@(i`L`L`T 2`L $Ϻ  `L% %$%(% ,%0%4%8%<% `L X`2 `L $ϛ  t'@)ޒ $`L P"@ "% 2$%a%a`LD "T``2$(a %a$(%a(`P"`"& "&$$`D "А `$@ O<`.H`Ѐ`"+"@ "%HԀ`"?<@;< 2?T` 2T`   "(?a "a %@'Ҕ H""Д $`ߒ `Њ $`Ѕ $Ғ ?l!@0݁㿘!( .` T"@  D "  H X $ " f  H$"خ  T.`"@ D "  H X $"Q  H&"ؙ X`<``X!耤*<b#   @ <b#*2 F  Ȓk @(? T `T"@T `?`(T@& T!<! 0-`@ +`!<1"(X @ +`!<("X\ @ +`!<"P"*hP @ +`!<"Ta @ +`!< #Xa @  +`!<#H2 0ha(<#0ah€5<   ` a$ - ll h@ `n # pp  @ ` n #h` d@@ n~ #,ilil ih@ `nm #ih` id@@ n_ #ipip  @ ` nQ # p6l "a? $a!<#\!$a? $!< M$&`X @/͞a @/ƞCH/`<7c$@/mh` <H4 <bЀ`24"4 2БH/`c$@/Ph` #`##p`lԀ`<ܟ@<ܠ#̒@% @` *``Ԁ``@`@% @<3D $#<3Ho`<!Pj2` D"D*`  aL  €"` 2 aL %Ho`<!Pj2> aL$aL*`    €"` 2 P`&`$ *e Ѐ ?a&`$*`2 $*`<ba>  $*`2 %*`<:  "(2Ȱ?@ `$ &`$ *`2 %8 )<ݤ #آT`T`6`* * e2  T` T`@ &`?@a@.T` `L$ *`@ *`fF2`> <`@ (&`XR` R` "  d?€-`2  &`$!`<3!8`   ` !!`"? j>I E>j<b#L&` p "R`Ѐ 2R`a 2 R`!!hl"a d"R` # R` a '<cD  `!< P R# ~XD`$D 㿘 㿘 <`  X`*<b#  @ @ <b#*2 _~1  2  ` 㿘   2   %$ ˨  ?"$ $  $X@$ !$@ " K &L  㿘`<` `X`*<b#  @ @ <b#*2 }ʔ  2P a, F'ilil` ih@@ 2`<ip   @ `2`< 4i`< ) a"`&`<6`@6`Ba,  ilil` ih@@  ip   @ ` 4i 㿐/Ѐ<3!8`   ` !!`2<?<;@  @/?/ 2 ?   㿘<;@ !@+d    ? 㿐<; @+O    &?!@(Ɣ  2!  b` a!@`  bV  4!4!4! 4!"6a"6a6a6a  *<b<38   !<b ?  㴀? 㴐 <; @ @?򀠠 ? $ $(" $ p l  Y V?ЀR G`L<38   !=?H`<7#$@,h`<H4 Ѐ " 4 2ЇH`#$@+h`ll!!h" d " 2<Ѐ  ?<; ?a"㿘t? &Ѐ  @?a l@"<?;    ?ʐl 2?&a  2a Ѐ ?a `4< ?; ?"㿘<;@ @*+ + ? 㿘<;@ @  ? 㿘 ! €? 2 gԐ €  ? 㿘`X< *` <b#  @ @ <b#*2 {  2U?T` T` "a(` / "` %"`#`{`{`z `{` 0+ & =" `{`z %   {   2 z @,  ?{"`0 ya % "À8 & ` `$U_a`q_z"`` h"7 "q<W``U`^`   "e   ] r "~ }`A  g t`^|̔ws @*|m  @*g Ѐc?p "9!O 5!WJQVKF; A?`&0<950? € 0'&   .*    =`耣  =?㿘 q ؀`! @ `@H/`<7$@)h` <H` 4 ` : "Ѐ`$ &l l2&l _Q & 4`" ` 6 4<b#` `*`@   2`Xߐ `ꀢ` 42"БH/`$@)`h` 㿘!!#!0<3!4 @)=H/`<aPj@2 @!D&!0#!D*@ 0$!X   &!X!\%\&!L&!P#\ '\&!X#\'\&!L&!P!\%\!T&!T 㿘! `   ?#<c  * # <c)d !!$2)d<yg !$@&!$)d<c H* 㿘!$@!00!<3!4 @)H/`<aPj@2 @!D&!0#!D*@ 㿘+@!&<ܒc̔ @@i <Zbܐ?&!&!8!<N!\%\#&+&!L&!P&!<&)|&+.+&!@&!D&!H&)㿐 l / 㿘 @ <b V -  &V  "6  l <b<[!& lc& & " "c5㿘 D ` R?<b#2RV @" ;? <bV @  "  1V   ` "`$# `"V  "`V  @ T,`@ " X"@ǧ $ X@ "V "@ǟ $V `@& T 㿘 2<b # @<b  # .`监2 xm2 0䀐20fW@gVfY@f@f@f@f@2 02 02 @0d2 @0~㿘! ! @' `@㿘Ho`+j2 Y &)&)&)*`)*&)&+&+А)@ǒ"̐㿘ې!($@ l!%`.!%eߒ !!( !eې)p H`kh2 "i2k iȀ kkiĀ( k( 㿘`x@ "n?a d "/i "BiE` ?` 2&ia ``"`p€ &iiB&k"`i "A `  6 &i3&k   " @  ,?&i <`l@ "  ?&i  <|` ?` 2`pi &i`p € H x@ w 8P8 P <;@ @%9  _?@O<|#`J "J t ")),! "!&!! ` 2&)! `23 t)+&+``) '` *` "`&)&+Ԁ ?&) `" @ 2* `2`) &)`@  t`" l@ l 㿘a b<|#` ` `p€ ^ @`p€ `i &i 㿘ikЀ@< a `2 `_ 2` Z   (0H/`kj2 ikiȐ" /"@&i&i* 0(08 H/`kj2 ikiȒ"@ o" &i&i* i@ `p€ /ii * &i&ia a ` ے 0<|#` kikЖ @i / @  2 `_ H/`l@2 n @&iiȐ?&i,@ a` $!i2 `p€ \ii @&i&i  2   `&pi 9ikЖk<|i#` 2 @    "  a b2  / 2 i @8&ii(Ei`p€ i ?&ii8`p6i  "!`pa b`p€ `p `p€ i ?&i  "`pa b"i`p€ `p `p€ i ?&iiAkЀ i@ `p€ /ii`*&i&iȆ/@ ̀ )  )@EH`+j2 ))#$@ $@  4) @Q)&)Ȓ@ o@$@$@ &) &)Ȧ 4) @;))Ȓ@ o&)&),.)"% t- - :  .<\! €)@ %H`+j@2 B @)Ȁ/  ))* ))Ȓ` o &)&),!$(   !@ ,,2@Ԑע@ 2 "  ` @ <|#` ` @$` ` 2 ` ; * )@ 2  v`   p€ /)) * &)&)) *@!&) `"!)Ȁ/ p€ +)@)&+Ԑ!@ %+`"H`l2 )Ȁ/ ))* ))Ȓ` o &)&),H`l2 )Ȁ/ ))* ))Ȓ` o &)&),, ` @ &`!2   $@ @2 @$ `@2 ` @2` `  `   `  ` ! $!Y ! ``0* `  `@  `@2 ` `  @" ` Ѣ@2, ``  @& &)`  ö`@  p€ /)) * &)&)! b p€ ^ p  `@/` `    @@(`  + p€ /)) * &)&) ) `)  ) / 2)v2 `` H"j))Ȁ/ p€ e \)@2 `+)@! @@"ߞM @" ` `@`  @` "!)Ȁ/ p€ 9+)@)&+ԐN!`%`2$)H/`+j2l )Ȁ/ ))* ))Ȓ` o &)&)* ))̃0(` @*@"H`+j@2D @)Ȁ/  ))* ))Ȓ` o &)&),)+&+!, `&+̐  )l )l)p ȶ`)l` !)p` !  p€ /)) * &)&)! `"!)Ȁ/ p€  2+А ƒ !)@ )&+Ԑ !@ &+ "H`l2 )Ȁ/ ))* ))Ȓ` o &)&),H`l2 )Ȁ/ ))* ))Ȓ` o &)&),F! A`  !  WM ! `3@/C+ H`l2 )Ȁ/ ))* ))Ȓ` o &)&),H`l2c )Ȁ/ ))* ))Ȓ` o &)&),H`l2G )Ȁ/ ))* ))Ȓ` o &)&),)l_ !)p_ !¢!` @ S H`+j@2 @)Ȁ/  ))* ))Ȓ` o &)&),H`l2 )Ȁ/ ))* ))Ȓ` o &)&),H`l2 ),/ H`+j@2 @)Ȁ/# ))* H`+j@2 @)Ȁ/  ))* ))Ȓ` o &)&),)l_ !)p^ !$)%<3) `d@ &)`!<x"P)pא&) &)!<"ppʐ` t`")@)@))Ȁ !, ")l  )l )l)p )l^ !)p^ !Y ! @ \ `@?2( 0   * (   㿘 ! )2  !* * 2``&)֐ c  d  `) @2!@!@  @$@ ` V  `0(`*@ `0(`*@ `0(`*@$@ܞ `0(`*@Ӟ "*! `0(`*@ƞ ` 0(`*@ `0(`*@" ! `0(`*@!@$  `0(`*@ `0(`*@`   `0(`*@ `0(`*@{ `0(`*@r @)* &) 2  2 )  " ) D @)*@&)㿘)  &)㿘 2)0?ꀢ 2)<3 `<*`"  <      @R $)?)@J U $) 4))*@$)㿀'P''H''') H<o:"?` `*$$%"#)Ѐ2)!`4d<o%") ")  y?od t?d Ta n>)  2 ! " !*@ #*`  %6))l)l` )h@@ 2 ))p   @ `"6)) H 6)    6)H $@+؄ @{'$? @o '>''>'')lH/`<9cD@0h`)l'䀢 )h'&)l'cD !!@SP;*%< @'*P?'P !"@)% @6 )`"%6))@")+̀  `   `$! ?H W`UH $@2? !@#ZM!@.P!!$@쀢2)'<; @ .P?'P)@VP )Ȁ )̚+;)Đ 2`(` `*@)@ J H`k@2 @))Ȑ  /&)&)+@  '< P*P?'P  P+̐? &+&+̀ )Ȁ 2)0P H/`+j2 ))ȶ"@   P8, 4 ;<    ))Ĕ@ &H/`l2[ ))Ȑ /"@&)&)Ȑ+* @$@"@$ H/`l2> ))ȶ" 4 8, 4 @;<    ))Ĕ@o & H/`l2 ))Ȑ /"@&)&)Ȑ+* @"@%@% l?V " 2P !$@!( !%`쀢"t %!@؞ @H`cD@rh`  ` 2"`'cD)l` )h@@  )p   @ `"6)!쒢 P ' @@  @@2g)㿐!'' a ` `*$ % Đ vH`<9#D@h`)h )d'&)h$DE `". l!2  2) l#;<   ` ` & t    t`@   &`$@2?Xu !`2> 2 ?!( "!! 2!?!H`D@h` `2"`$D$㿘)p `"! ! `"  `!)@+̀    )Ȁ     2 A!$@"!!( !%`2 C! 2 W 2  Q2 |! !`"  "  6)6) |@ $ 2 0󢀐20ـ2 0%2 0@2 @02 0b2 @02 0P2 0l2 02 @02 0&2 0B2 0|2 02 02 @0【2 02 02 @0+2 @0=ZxuZx2 @032 0p2 02 02 0Yx*@㿐 |' W'H`<9#D@h`)h )d'&)h$#D` #!  |@ " V 2 €!H`#D@\h` `2"`$#D㿘2<j#00@ @* &`  * @& `  @* &   ` *@ @&  " `.  `  " @ * $ p!''' ''''' '@! "`"`"` " `"`"`"`"` " !!!`   "@3)))Đ*@&+&)&+1`"!(! `2 !()Ȁ )lXH !)pXE !!( "6 !$@"1 Ѐ$  ?cD  `?!@$  `D?c  `? !% .!%  .!%!( !X)l!( !X)p € 쀢€p  ܰT!@% $<;@ @@В Г*`?2`  '<`  `ԓ*`?2`  '<`  `ؓ*`?2`  '<`  `ܑ*?2  @ @'<` @u@ r<;@  @'В '<`  `''<`  `''<`  ` ''<`  `//<` @@{ ܀ `<  `//<`  `//<  `//<`  `//򀎠  ؀`@   ?а 㿘<;@< a 6@a` ` 6`` ` 6`` ` 6`` `  .``  a`@ a `<`   !.` `  ".` +̀"! )2+ )Ą" )̘:`(@ `0`K "` :` !    ! 2   2㿐!// / /7<;@ @    ? % "" `"  " "`" 8" ``  "  ""   * !* "ho "!0;''' ''''' '<@  @B    2?/W/ 㿐!; / / / / / /<@ @    ? 㿐<;@ @    ?! *!*`!*!*`!*!*`㿐!; / / / / / /<@ @є    ? 㿐<;@ @    ?! *!*`!*!*`!*!*` 㿐!$ 2 / .`€:`0 " l㛐 l   n㿘T` T` "a(  "<6 d "<   `Vb`W=0 "D=0 "V  s+D=0}tR =0t `uM`  ` 2 `eN`p=0_`/=0Z ` ``=0L  "8  =0@~=0<^83Β/* %&!;<  !&! &  &  &  :< .<  !`@ ! `<  !. װ  "<  . ǰ .°    L    Zw "a$ ?0a$   $a$? @*@$a$X a a `y*`:`u H p"` ?0h ``؀`"`@``] @Y <; S?`|` @&0Ia `i,<; ?&8<;<  !&! &  &  &  :< .<  !`@ɔ ! `<  !.   "<  . ݰ .ذ <3!8`   ` !!`2<ư?;  ! !"< @ @ !!" < @ @ !! " < @ @  !!" < @ @ !!* <! @  @I ! `<  !!* < @ @ !!b* <  !!* !< @ @ !!J* "T` G?T` "<0A;  ? 4` a$ .  a($a$)*a%a$*@#$a$; ?a`2 &0<;   ?  a  7& (&  HXhxɈɘɨɸ㿘  "8@' <; @  2 ?@ > B?@㿘<<@c̀@= "8o "8 <;@ @ 5 !?@@&<;@  @@a 2 ? > B>㿘<<@}c̀ " 8@s㿘`,o!<< ?@`#̀@ $@@Y#̀@ $@"`` 6```?`" " 㿘<<#@0 "8o"8 " &<;@ :&@ &@@$" @<;@ @@@& @B>㿘<<#̖`@   " 8  <; @  ?򀠠 ?򀠠?8  *      :" <; @  ?򀠠 ?򀠠?8   +     :"   㿘  <;@<  ?#@ / @ @ `$ p@&  p @? 7 T P - ;"8@@`@4@3   , ( "  @[! p< 1@   @ "pNp$   0 @8% `@ o`" <@:@ s%@%@?㿘`  ?`?``"@ " ?  :     ? ?;  @B; T !  ?㿘 +?* 2 `'<o#*` €<c  &` <c!,&` <c!h&` <c!&` <c!&` <c" &` <c"&` <c"&` ?` "   € Pj@PW8@POS@㿈@E 0<.!ܒ@& @: 㿘!<!@ " 㿘 < ,.    `  $@  㿘 < h.   K  $@  㿘 '  h ` '   L.  '@`2*. 4`.` ( @  g@.  +@(@*` 32@*  @. `( 5<) .` 0`&(0&㿘<3 ?a &` ``L ``h&  +  `4@ * @ * `@ 6. * @` `g*` @ + * @ @,``3@ 1 ) `@* @ * @<@!@(`*@@ 6@@ @ `#@* 2`@ #@ /G` C@`!`" &@" &`&` & `& 4 4 : 22 22 22 %U"2 c3 3 2 2  @@& &    < dN !< hN !㿘<c └ <<*┐!Rc㿘<<!` I㿘  < ,.  `<!:!㿘 < h. @  < @ <@!#"㿘 @ @ ?```4 `H  3 +  #`T`za##2   ` !   ' ; @      2*@@@ 0(@  @  Oز`      @& && & & @< `  8&  2` - "@& &    < lM !< hM !bH#;j&. 0#`v'''''  pk @ ` @$@$@`4 7  <;@ @ Д2 &?@ߔ&@N    2?K;j@h!T㿘<!r 㿐'' n < dH`<9#D@h` d '# d$#D 2$>K  !<  & <!a2` 8 $@"?!H`#D@h` `2"`$#D "` "㿘<! 㿘< h`"<<!   A ( X ));@ @` < @ @@2 ,&@#<a ?݀@2`0?<`"4`` 2$ $㿘""< bb ?0 ""T"N?0 "?0<; ?& @ !! `?<;   ? ?<a   #  4# @ # # a `V< dLP !< hLL !İ T@ !! `<<;a < ?& ?    ? T  @   #@? ?4 *  < @ a  y?w T@ !! `j?<;<   ? 2Z? V     ? H? ږ  @ <a " a ""a `. < dK !< hK !$ T@ !! `<"!T@ !! `? 0?㿘 7  @@  @0`(` `@@ 1 ) @`  @3`+` ` @@4 , @`  @0`(` `@@1 ) @` @3`+` ` @@4 ,   @ 0`(`@ @@1 )  @@3`+` @ @@4 ,   @ @0`(`@ @ @1 )  @ @3`+` @ @4 ,  5z@0`(`@ 1 ) @ 3`+` @4 ,  @ 0`(`@ 1 ) @ +` 3`@ 4  , 㿐<c`"" !,!<c<"! $@C!,<c* "c .2 .<@"" "  ?*"@ *`" * #* *  㽈)T "i=Ѐ <3!8`   ` !!`<ޤ <,a#@@  _@/54 1 /0=0123Ұ=0):"䀤7 א#6;=?0IH:j<E"8<A{D=0M L9JJKj=0Nǐ`=0q"ŀ0h"nd"z  b c=0Ԑesr<l k:<iKjA=0mp=0b"b"< rb=0b"< b5=0b " b!bU=0b c<3 b p=0|@ ܶ<c# €t l?#6 @А   `@ǐ ܒ<c#  €0Z<c #L +ݐ `?  2K?0I`?# ,=Ƕ <ܐ"  <b*!< 1 u0* ' <ܐ"#; `W<"   " ?  ?  ,   ? @,  ? @,  ؀`" @   @ < #;"( ' < #;" < #; ?0  g,  2`  *  `@^,   < #;2   &0<3!8`   ` !!`" <;   @    :?cLcM0@ <  ?& ?@|;  @    t?O cFcG( 0f<h!*` +`<   <!2`@ & <"`""< E?60A:`"<<h*`!` 0 " <"~@) !<ia?r"a<!+ 2`@ 6 <!*` ?0 ? ` Z<h*`! -<ia  T@@ !! `?!r  ?a* "0"~2 "*```2! $!<* @   "2T@ !! `<* 2 ` 3  2  @ 0;  @" " ?cH耦/cI0 0<i"h( < !K    @  *@ K    . f K 2b?0`Y<i`<i<i <ibh bd(\"     @, `   , `"  bh, @@m逦 @h$@`d `  $@+<i"h*@ "@ ` dbh"d"X%d!" 6.&.   "\bh""\ @& <i"\"h @ " @"@ `"\&@$ @4"\<i"\"h*@ " @"@ `"\<i!` d%"\`"" %d%`bh@@ <;<  <k!h& ? 2?<k!h*`   <jbh@   ?<;    ? {?<j<kbh* "h < @ @z ـ ֐ 2  *`' Y\? * 6 ` , H`</ Pj2$ <:!T@ #!T@*<; 5?.01*@+ # ? <`<"`"|?<; @"     ?耢 <ܖ? 222 2 2` `""`;  <ܐ" @`    ?; <  ? ֐ <b!>`6<"̖  .  "*`! 2 *`  >*  .  @ ?60<ޖ"|P @#;< > . P@  >! 2  >і ϖ  >?˶ <b"!DH`</ Pj2b <:T`"T*s k >m?@mia<ܐ"J``?`?"" R!</ D @ɞV@Ð @מA >?< ?9?!<<ޤ"| #<b!<bP. @ "a<! 2  a<"  "t"   >$P "̶.@ "<b!  ?<b!< <b"t ?  <; <  ?     * **`і<; <  ? ʐ                     ,`  <#ґ+ 2 `,2   ,`@2 * 2 .w?@ّ2 .2 . 2 `,2   @ɐ * 2 ?0^@ 5 ` X?,`2 <"#Ѐ`<" <,,2 2`  >E=<b< ` !''''''<ba<    !''''''¨%#?oq;  @!    ?ckcl?ꀤ2'?  $?$? <b' '<'   $?$?$? <b' '<'b ް7 7<@    c a?򀤠’ !<b'!<'B !<@d 0<;  @    ?򀤠 ?! <@    ? ?@5@L?@h{@}wu?<; @{    e?<ba< @M0^;  @f    ?  <   ? ڐcfcgҐ <b͐?a< @W0<ba<@M)!8`   ` !!`<c *c<3!8`   ` !!`<c?*#=㿐<c# ''H`<9#D@`h`#  '## $#D <ba< !   ? A ! B;Ho`Pl2 a؂` @!X '!X,`㿈   'P + P  H`!</ Pj@2 @#<:aX%< ?$aX` @Ҟ*@Z <b!< ? + #Ho` Pl2n <!؂` @aX 'aX,`8?$#"Ho` Pl2J <a؂` @aX 'aX,`?ꀦ8<ސ!-  8'@ޒ$Ȫ?#-;< @` @   Ð`@ `z 2< 4$;<  `   *2<2t4: @7@*< ; `  [?,  :`@*`2`b``@ 4 :` 4: $ "!;<@ @*`*`2`>```@  8< <@; `    ,  %@:P&@ > B;Ho` Pl2> <a؂` @aX 'aX,`㿘 *  Ȑ? ? 2 @02 0A2 0d2 0;2 @0c2 02 02 0㿘<c#`. `"@.`@  "/  &@@q" .`@@a8` (, ``.`<<cp*`* `  (! ` <p* `(@2 㿘<ަ!  R,` `    `>㿘< <e;a`  ?  < .     3 Ͱ 㿘< <e;a`  ? <ޤ!#<ba<. *` @ ? ,  a< 㿘< <e;a`  ?    2    <; <e`  ?   @ 2@   ` 㿘<al""al  `"$ , @   , $   " $ 㿘<ސ!. a  " ? & Đ㿘<޴!  N-a H"G `@2B !   @ `@@ @`  ` @@ "` Ԥ  `% !o" 0> 㿘6` |`, Ò  & `|"?,2  |@  ?   $@??@ܔ ?* 4 .4@  &  㿘<ޱ. !a@    (?   &    2  "?  & ?@ $ a "<al""al& &  㿘<ސ!.  !  u?.` 2o 0 g ! ,``"` ,@ ?# .`,2`b 29``?,``ߑ,`<al""al* ?2`@  *`*2`29 2*`2  В  0`%!"0  ``㿘<!l<ޒa. @a 2F  "a"@? $W5 " /<fa<ec`` ` , ܕ4  2 $ r  a@ %lR  %l㿘<ޒa* . @ @ "?a2!?@ "  1a @ "!"@㿘<ބ. . .` (`#(   @ `(@ 2 ! @66``? $@ م(4+`0 ?<ބ* 2 ?@݀)?@?@ ~?<2! a! :` ?(  :`|  `?(?㿘/<"ap㿘<3a  <!ap㿐 H <!t` '<,``2(`@鶔<m!p @m 2 (`?& , & \& \ \ "!@ 2``Ց,`   - @Ӑ` & \`&  J   <<` t,`@ 2` c@e&@@`Sl㿘  " o? h@` 8?" T 㿘,<J##J   JK   JK "@ 2<  @ * <!t ` " <L~#<<<#XaH(<<<<$#Xc8  & & & %ܢ  d?& & & & 6 X6 Z& T. o&  `@/ `6 P??㿘<3< Բ`܄#"X  6 P& & 6 X& T. o& . `& & & & 6 Z@2" `2" `?2"  ` 2"  ` 2* = ` `2* < 㿘<!t <  2 @c@裔$  ?<t  "tt( 2" 㿘^,?  J  ȐR  Ր^-?0^* 㿘^ RАǐ^㿘 `\`<K x p  p@ :  Bo    p @P21 B9-  @EB.  `"$ @$ $ ^4 t , iMt$  \ ` $` \` @@ ` $`$` $@ \P 0P ? (  2` 2@ 2`:2@ 2` 2@2`㿘 \ 3?  & $     i /  h /  kc/  j /  m0/  l! / @2@>..23`f`?     9    0>. . 17@ `? >1?7 7  >7 7 㿘 | $   2 0   ,  `,Ő $ 4` 4@@ !@  cd@ d@ @!@<"J  | < J"@?4@ B4@ | "  @ "@ 㿘 \``*    `@`L`0 `$`Lk$`0```X $`X``P $`P` `L $`L``T $`TS`0 O$`0  /?@     `$ $ 2`(<J\"P`8 `$`84,`   =$`$`( $  ` \@ @ $ $ \$ <@@`* @*`@*`@   ]]A4 tL`  $` 4 ,`` `*` $` ` ` 㿘 \   k   @J 4`$ 4 ` $ ` p $ p$0 d  `$ d  "@$ <`"<"<" Iݐ 4` 4@qِ0;0+< h`$ hIɐ"4` 4@r]Ő0'     * ` D $ D  " $ D $ D $ $ $   *  `$  㿘`\` `<@I"ؐ &` 4  &4 >4$"ߐ""`f``@4"@?@<`$#? `$ &`$H`</ Pj2 <:Tb"T*`4 $`4(`0 $`0?`|`<"@* I3 4`|  @ "@Ր(&`$ @4&` P \<m`<m`<!x" cД @Ԑ   !<@`#IN?4 4`|?`  " 4$ $  . & $&  22` -` <@Ő h , * ``$ ` , * , ?2* 2@!@ < , ` H  $`4'㿘 \  & $. 4 4  4 3 㿐`\`$   @`<#<3a`H" c <@H#P 4 `$ 4`\ 2`2@ | <H#8 | `"d |?` ?" | ` " a &`H.`&`$f&` f h \ѵ  @4"@?@ < sP <& < ,  @ $ ,** `2@*  `* 2@ !@t@$@@! @*  H  $ 5<3! p&`H @Ş2 >  @4"@?@2&`$ | " |&`$ | '$  \ 㿘 \;n   P  p?& & 0-& &  t '  ? N 0> $N00(@*0@ t޴ 㿘 \   M  $ <3! 3*`0C $ @h  @ <3! 3`3& $2 2A P!@  4@0@?*@4@& $H`</ Pj2 <:Tb"T*2 0 2 0㿘 &  &  $& & @G4`@5`  " $`$@`㿐(  h@. ?    ?2 <"P$@ Ƞ? @   ?2 <"G? " f? $` $($` $`$`$`$` @!$`$`$ $` `$ "  ` $`,`, \$`($`0$`4. . . . . .  .  . 0   .  .  .  .  .  . . 0   . ?. m!Ȳ#  @ 2?? Ȧc  "? <F"  /@㿘 @  <F" D`& D@ <F" D t` & D& t@ <F#  D `& D@ <F{#X D  T` & D& T@@ <Fm# D `& D @<Fb#@<F[#@  D T!a& D& T@ <FJ# D  p` & D& p@ <F<  D `& D@ <F1 8 D  p` & D& p@@ <F# ` D  p` & D& p@h @ T!a& @& Td @ \!a& @& \b @ l!a& @& l <E  @ \` & @& \a <E  @ T` & @& T``@ @ d!a& @& d` @ `!a& @& `<EՐ  @ H` l & @& H& l` <EƐ  @ X` & @& X` `<E! @ `& @` <E!8 @  l` & @& l` <E!` @  l` & @& l`W 㿘   ,@ b $ * @*`@*`@ ' ?*@ @ `;   @ X  H`& @& X9& H ;     `$ $ 2  H && H ` \@  @$ $ $ \$ <;$ X XU4 tG/ 0 8 @& 0& 8 b %% ,@  &  <E"!㿘@ cߦ , ` 5  `$ @`c 2$ n$ ,㿘 \ #* , 㿘 \   , ?  ΐ ? <Dې"P0$@ Ȱ? @  ƻ ?<Dɐ" @*` 2"4 '<` `"4@ "<*` "4"`$)@4"@"@4 `$0 `$Ho`</Ph2<:!T"!T(`㿘`\  $`$ @2!<3!`H" '<@Db!  !&`$&`H  @4"@?@"F   2 ?  `*   \, ,`h"@,  @~@ 8h"@  <3!`" `% &`H "@ p @О2 :  @4"@?@2&`$  &`$  \ 0㿐;n \ p$ , @P2t@ .    ?(0NL  060t 6* `  @? J  0>  $J00()3 &ߐ` .    ?(< (*,( &$20 (;0("@"`D"` D0"``"`㿘  $b b ?  X b ? ? 2  <C`!P<b C\!x  &# #   > #  ? <CG!<# CC!(`c0 0" 0"c0c, 4" 4"c,c( (" ("c(bH @" @bHbL $ " $"bLbL"bH㿘 `( <3 <<*ሒb @   $ $&($&(&( &(   @   p @2&@9&@?`  @   p @2&@9~&@?` &9 +, ``? ? @ ` &`&``, &`&``\`%ꀢ &`\&`<@8%`, ` "&`"&` "@ "$   $А&  " " ? (,  @"("($"("(     ?f   ?㿐(4  *  <*   '&`'0Bl!㿐(4   ' < ' &`'0BW" 㿐(4   ' < ' &`'0BB"@ 㿐(4 <B8"p0D.   '?&`'?    (4  `?4@ ?4@ 6 ?6 ~ 6 > w>㿐(4  <A"p1?h#   '?&`'?X T P L (4  `?4@ B?4@ 6 9?6(4 ] YV *?NKH,/ +( *? ,6 㿈    $ "?$ "?2$  $ ' $  'S   &(4?$'0? &(4$'0 <AT"<"AO 㿘(B@46(B   6(B   @! ?? 6(B (<A$#(0 ?Ȕ* *6(B2ٔ  ?㿘(\ (X  `>&(\ 6(@ (@ 6(B(<cH<#h<#x @  &(X% (\ ?2&(\(<@ڐ#@i <(@А#0  (<@Ȑ#ؒ &(X&(\`<3!`x(D+&(L㿘 Ŕ 6(@ 6(B k 6(B d  @%<3'<ˆ ?   6(B (<@#(  *6(B ?2 `x&(X&(L&(T(D&(\+&(P㿘Ēh& Ȑ %?   F ?<@T!(ː<",`0(ʐϐ ( *  $#   *`@ $#  * $# $#@$#D$#H$#L$#  $"   *` #$"P$!$` ($` $`$`$$`  $`,`,$`($!$`$`$`$`$",$`0" `$" # $# J㿘<? ` ``<? 8`<? H  >6<? `<? p<?ڐ <?Ԑ @<?͐ <?ǐ <? Ȁ<? <? "<<?!<?!; 㿘` `@h "`    + `(h$h#,  @2&h$d, @ $@`p@'2hd6 hd h  ` &hd, @, &h$  h`-`` '`;-`hp-`h` &hp&h`hx  &hxb%z%`@`; &5p  "  `? ? @   $ $ "߰ $  \hĒe $ $ \$ <4% -`  "$ "$   "`"% \@(8h$\2$`57     `$ $ 2   ` \@hĖ @$ $ $ \$ <4’RG -`  "`"% hQ4t@Őh` &h`` -` l &hh<>! h $`"+" h$h@4"@?@h " ? h" $H`</ Pj2 <:Tb"T*h" 㿘` `@h "`    } `h$h (*@ @2&h$hd  ` &hd*@@"hd&h$s h`,h(`bh, *` *  *  ࢑*  @?*  `; hph hx`&hp&h6&hx 4b     `$ $ 2 hx #&hx ` \@hĖ @$ $ $ \$ <3 QohQ4 t?h` &h` " `%@,%``&hh<=! h $`"+" h$h@4"@?@h " ? h" $H`</ Pj2 <:Tb"T*h" 㿘<",` \<< c<< cP @) < =!X?$(D$(H- 㿘 \ )wD $X$\   p @22$4$      p @2$4$   㿘`$ !`\#<3a`H" '%<@=T!(t`$(t a p&`$&`H @2J 3ܐF `$ @<@=4!9 (($@@"@ (  \h"@ ($"    h"@  <38 (" &`H  $( "(($@4"@?@2&`$  &`$ 㿘`\`$( ,!<3!`H" '<@<!t`$tt ! &`$Y&`H`$ @윞<@<Ґ!L $@4"@?@ "A ,`, ,  \,  @,`h"@  (" 8<3!h`"@ `$&`H "@ p @H231$@4"@?@2&`$  &`$ 㿘 \ @(`㿐 \;n  c #  p ?$# # `"  PZ #  Pb? t @?#$#L$#H$#D$#@0Ba#  @$# 0; 2? 62 t @)  ` ` @? K    2`@: $K2`2`*  `+  0@&ߘ`$#L$#H$#D$#@#  $# 2 0s2 0Cllllllllllllll㿘-<m   ,    ` @ "`@;@瑒 2   ` @ "` @&@| Ԧ 㽘<n<m#"a؀ L 6*`"`2L` " H )<` @!"H@2;`&`,, !"H ;2㿘 ?& ` @x! @  ` X@   ' p2  "@ߒ  <;b"x $` P" "P" ""  @`  (@@ 2@"@" & ` ( @Ӟ`f D <@ @ #\#`#d@ɚ t €쀢<n#```" @` "@@@`2``$ %<`$`"@@ $`" @@ P(2@:@`2`$@ `O` `" @` "@@@`2` ? ; < @ 0%<n p2  " ?  d` @@8'' #\#`#d@P쀢 2  2  <@ * p D( < @B @`@@2@` `@"&  2" 쀢 `@  X`@!  @"    `` `2`  P'X@ `T *@\* d `P-`-`-`0` %` %`P%`T-`.//////` ?%% `-@ `-A `-B%'T'''%H/ #<]b8l2]  #\'<!@"X,H*/  @鰞D`%:` 2 ̀` ̐ p p ΐ    { x?  //#%.////-C'''%H/ 8l2  #\!@d ,H*/  @W % * :  "3 !" -?-  ?-- @͐`2 @ɐ`:  @Ő`J `P2`* *`  %`P 2   *%`P`P%`(2  a > 1%`P ` <!,  €`P  %`P`P*@%`P<"9P`T`P* ?%`T%`P5`     `? * ??@  c *  %`P-`0@'<n#    `"@`$@%`$ 2     -`12 `P   2`P`-`1`PM`1 ?π` %`P   `@%`P-`N` `P ?%`P``P %`PC<8"`P? ~%`P  . *///#%///-C'''%H/ 8l2$  #\ *@n ,H*/  @a %%` @" XX "@<8#9 `P  `%`%`P` <6Y#(@  @@ 2@"@%`%@ @ '@T "  '@  '@  Ѐ      㿘` <6%#P " `P?2`P<6# ` "  ?+  "  ?2 ! ??`# @  @ 2  A`@ ?" ?2  2 @" ` `H   <m!؀ 2} h`"p, 6u p2  2p ` `T2  2h K 8@@ `  (`n`    $ $ "  2 "@$ ` 2`  $  2 <  ?< <& <$ ("<   ("@& 2 $ $ $ ?<$#%ʒ #?#& &  `(@B6 ~6 |& & . C`. B`` . A`!. @6 6 㿘  ` <5S#`2@  ?   ` <3 <<*ሒb @   !<]`H <m!؀ @ `h`"`p`,  `p2   `<]`T2  <]"8-<`P ` 0  ?+ (  ?" ??`# @  @ 2  A`@  ?" ?2  2 @  ?"     ?)``?,&א`H/ l2 Z `P݀`2`P``6`<4  M 8@% `  (`n`    $ $ "  2 "@$ ` 2`  $  2 <  " 0< " 0& <$ ("<   ("@& 2 $ $$  0?$<%@#$ #?#& &  `(@%6 ~6 |& . C& `. B`` . A`!. @6 6 㿘?!6 & 6 `( @ p .  , .   @ 㿈 !'T''H'L'P'X6   <4  HŸ <ma&! "a p E /<m<3 <<*ሒb @   <]"8*@ H <m!؀  h`" p ,  p2  m''H`<9#D@h`   '$ $cD<<" a)<+< ! H`<m!؀  h`" p ,  p2  <3 ȑ* @ ` h`3%"ِ H`cD@Fh` `2"`$cD!Ho`8j2  H  <m!؀ V h`" p , N p2  I`<m"! ,`4 ,H2@۵ H\& (TX& & ,P& L& &  & & & & $@ۢ @ALP& l ~& T C 6 | E<b2  @. C C. 8. D6 &! $``2   ᰐ  %%ᰐ& i  %ᰐ %& 84 2`<3 <.$"@<]8*H*o`   #6&4Ho`8j2 j $``2  < ,@ِ< ,@Ґ !6 6 h "$$``2   `,<€cX @t`U0`,<€b`0(@&!$``2  @0@Ɛ㿘@  ,& <mᴒ` !6 6  & & <<m"!"<ma" <"aH`</ Pj2  <:Td"T*㿘H`<]b8j2  +<m3a  %a8*0L) /`` <@@@@  @Ȑ,@1(@ V$ .! 2.4 4 p  "p,.@ @㻞 @ 2 <a㿘 p @U E &! D& l . C | & T6 ~@ <ma   "a "aa& 84 2`<3 <.$"@<]8*H*o`   Ɛ#??6$4Ho`8j2 L $``2  < ,@< ,@ !6 6 h "$$``2   `,<€cX @B`U0`,<€b`0(@&!$``2  Ր0@㿘`, ?4`,2`H" `, 2 <m2 "aؐ?* 2     "  !o # H  "`  @[ ` !` #@` ! &!  |!6  6 6 ~€㿘!2S N 6 (H`1<m!h2 <m0/     !a<m9<m!<m.#@a*@2 .@!Ą '!*a. aa0 ۰ ( 㿘H`<mj2c  <ma 2 <m@4 <m<m<<̑+`@ %"p" 6` & *2` ?* `!0u 0n`ؐ *@ * * !`2 @ <m!*<0Q!㿘/` * ` @X㿘o  * `Þ㿘 Q  m. Q#/c & ! @2 X$$  ?, @ ! , A   , B$ $ 4 ~4 |, D$ $ $ $ $! `$ & 4 4  Q@6 Qp2    ! Ԓ  Q@ 6 P<!2. Q P@ * w@& P(& P㿘<2! '<%<#<`   1 1aР  $<1!ؠ %<#<`   1ߐ 1ېaР  $<1Ԑ! %<#<`   1Ɛ 1aР  #$1<  a<",  <"h1  < `1"  ``    <1"801㿐`@ <n#<`" b@` "@`b@<"8<"X@#`'` "@@J  $ @`2`$&U&@SO M<JbbL``JL``JL ``JL"@`/?<J"`"`L  JL   JL   JL "@ <L   '  @ˌ @<JbhLbh J`L   J`L   `@ܥ  K<' @c `@] ` @W@Q <"0Ø<nc``22@`2`?  2 2 2 ? ` JbLb J`L   L J`  `@=  |?' @ `@ `@ `@ <nc`]?`22@`V`  2 2 2 2 (A?퀢 <n<?# "  $ (`"@ 2 ( $ 2*?`$ `"  @ $ !   2 `"  "` `"`"@`'` X ?㿘<n# `2 <m<m!Ħa  <"- 2 #<m %<ma̕, @  r!2 *aà "!2`e*` $a!^2`$&!$<n#<  "a 1<m㰀   㰀"Q?`"I `0? ( n,: ```n `Q* !@Ի2  ``, ``` ` `Q*  </" `Q*` p2  a " @L`0 " @ `Qn@ԏ*`@`2 `02?# ! @ }  7<m3<5 ̒   , Ē  ڒ $!  2`   ,  %    ,   &, !c/ ?- 2  ! @``$5 <&/#X0&<m!` !2 @A<m!$` !2 * @2a}<m!$aĒ%  "&!&ȁ㿈   <n `2 c  H/`#<]b8l@2V @ @. `,@  `€. ` `` <n`<.#0ʐ@ <n&@"<n#!'<n#<$2 `2  b'''$N  @.$2$#!<$2 `" @2.d#2$<`#<"8<!x.T #$2   Ř t"€2$㴀 "# `"   "@ 2 #,``"$`  $@2@㴀 " `$ $`"@ 2 $`$ " @`P(" @`2` 2`㴀 ` `"   "@ 2 ` @ 㿈<n##"  $@2 `"` `@ :  z2 2ck?"  $@2P $P2 2cQ$2ID?# ;?#`<P $P 2 ) `# @ !-t  `<? " c? "$  2P*`  $P-U@04 $  2P22$c"&c$2"#<nc " $ (`"@ 2 ($`2<2c2$c)<n$-<n$2 `2  "  ''' $E  @ܭ$2$cr$2 " P! y $P w$P$n X22$cN$Fp2  A#2!A@ <aHRْ  (   2  R̐ @ H `"\@# " Y- Y "T$T " # X`"#J#@2 `@7 `?. `2$䀢 ##<`#<"8<!x,s  ` -  @` @2 """@ @ #"<aHRo 0,Q P0 (   2  R`Ԓ H㿘 h @<nc` ` "@ `"@ $@$ $ 2 @`2` `"   "@ 2@ `"& ` "@%  $`" $@ $ " P(2 $ P P("  2 $@`2` `   @ @ 㿘    : @ :  C<n#/)<n`'?ߦ# (`"`$@`$ 2@`P` `$`P`@2` ` $``  3! 2``P 7$`P@`2 (2# @2`2%#"@ 㿘   6   0 0 <n"䀢`<SY p(㿘   0 0|㿘<ma   "a "aa& 84 2`<3 <.$"@<]8*H*o`    #??6$4Ho`8j2 $``2  < ,@< ,@ !6 6 h "$$``2   `,<€cX @`U0`,<€b`0(@&!$``2  0@ې!A@2 0 @2 0@2 0ם@2 0;@2 0򀐠2 02 02 0ِZ@2 020O2 02 @0̐@Đ_@2 0H㿘<nc<n"c<n<n<n2" 2?@ <n#<n# ##2@ 㸒?"#2 2#㼐 0#`x㿘 ``x2   `2 {  Lc& (? c6 ,& L@ 6 .& H<'!`< @ p<n<n* `#*`c & p6 26 0 ###c   & p. Y& @& & & 4& 8& \& D& <& `& T& $&& & & 6 , X0& d T<n& h \* 6 n ^(6 l `2  #* & p `* 2  * `& p& t##@ 2@"@㿘 <n<'`!c""c 㿈'''<"& U  @5& @㿘$ ` ;`:<;@<  ? .@  @$$ €  `@Ѡ8 < @ <?  @ @c㿘 ?& ` @ž㿀H`#<]b8l2  z '''& <#\!P  , @اH`l2 & ! "C  ΐ  " N@  " P& " P" < P >+% P(̐"( 2 "  PN@ <("  P2` d% P&! <2#(  (! < Γ2#` ` (  &! T     "   #b8*p`%<;@<  ? @  @``  `@?ꀧ`? @  `  >4 ɰ?@*   <"2` < @  ?   < @@Q` @< @@G逤  `* @/ #  #    #p!0!0 Ho`#<]b8l2  Q '''$<#\!P,` @~ $< @ <? C @ ̐@ < @ <? 1 "  @ @ΒHo`b8l@2u @ #   ,@`㿈 (?@ !?c@" P4c`"  ```"  c@" P @"fT cc@c@"HT @kc@"-< <;<  ?    $`  *  *` * & ϰ   `&ɰ ;<  ?     2& @ !! `? P`@`  , N$ P @ !! `? P @ ?$ P, N dT@ !! `T@ !! `n?3j! @@d  *  //////# S! @@M  * //////#k =*`//////#] / *  ///p///L   * //p////;   $`$?㿘<!@2 0B2 0;W@2 @0㿘< P&㿘 <"2`  <%<&X &<& `㿘> < h% `㿘`̒ 2  X` ` 8 `2 `<% p `< `*`* `@ * `@ @ %֐ ``<%А ` @<%ʐ ` <%Ð "<<<   <% `!<٠ Д @ `% ``` $< ` ` ` "<<% <`!< Д`̒ `%<!% <%!(  <1< @%} P & @<%v `㿘 @ ` `  %< @%dX & @0 <``/%W X  < `<%O!8 %K X㿘< @!H A%A 2<%>!p& E㿘> <!%4 `㿘<!%-6 㿘.`2 * ` c$ 5?@03`@   @  @ ? @ &&(@?c  ? &&@@ȴ& 㿐 $*"U@ ?   "   * @@   `B? ` ? ` `* 8@ 5@ܐ@ِ`@Ք  @ђ` @ʢ @"$@@ @’@ɿ@#2?2?'&@ɱ@ & ?㿘!>@@  $ >`@ɖ$@@А  @ɇ@"?&@&&<$<<<<<$<<<<<<ϰ$h$$ψ<PHѴѴ|ѨѴѴ|ѴѴѴѴѨѴѴѴ㿘 h <3 X<3!@ X& `& h"& d㿘<3! ` X& $ h$ d㿘 !6 & & 6 p &p.0. , .   @q㿘Ho`!<]"8l2 ,`㿐  p 6[ P''H`<9#D@3h`   '# $#D<<" a '<)<!  p`<3 ȑ* @@ `㘒#!A ɞH`#D@h` `2"`$#D! P6  㿘H/`<]b8j2 !& 6  $  4`?@?#!& 6 `  @Şb8<#'#b8* 㿘?!& 6 & ` @Ҥ㿘?!& `6 & ` @҉ ̄p0`?㿘 p E@&   & l |& T D6 ~ ,@. C 㾘<ncȔ @ E A*`, F$`2  "5   <" 13  @ʘ!@ʕ E<"2` !$ T, C$ l4 ~@#  l@ݔ  #" p @ѐ E $ l  |$ T D4 ~ , C㾘<ncД @ȿ E A*`, F$`2  "   <"f P13  @F!@C E<"2` !$ T, C$ l4 ~@e#b  l@ȋ  ђ" p @ E $ l  |$ T D4 ~ , C㿘  @ѿp<3!<@l'''''''' .<]b8*@H*/  @ѮH/ j@2 @ Ӑ㿈!6 h`C#`& <'''?"`#& $<,a<]b8*@H*/  @kH/ j@2 @"   X @2 $(@&!@*   &  #``@@" & `@ & !82 ̀"  ̄pp2   ΄   2``|"`<2`~"㿘 & $ 4`2    !6 $4@ 㿘! & $ 8`!  6 $8@ @"&  㿘 !! 6 & & $ <`# @ "& ! 2  "   B @2T  "T2 B 㿘 !! 6 & & $ @` @ "& # 2  `"   `T  "`T@`2`T 㿘 `P2  "?1 !` C!<!*` €?*1$!<  E * )14  ܀  ?#$ @a*: "1: `< ē*` €1 @L " $01   $ (  $ $1 1 㿘  ܀  ?1"% @% ! 1:`  :` `<!H*` €@   1 1 㿘S 2 1  ` 21 ``<!*` € T2`  *@1"T 1 1 㿘 ( #     " 2 㿐 `'` @` 2  2`2` `"O`8 20  2+ '@2#   .2.c2 4ڐ2  .2.Q 2@`2` ` `@ 2 `2` . v `2` "+@ @2" %0`2 2  " 2  .2.  2 @`2` . s  `7`  `     2   `2@2@ "@S2 @.2.@`2` . 6  ``"@75@@2w  %   B B@2  @ @ 2  P @ 2 Ԑ d` 2 B22K  "G  >?߲#/ B B@23  @@ 2+ M@@H @ܐ@ @.2.R@   P # P.2.D 2 B2 2@`2y` . "  `h `"`@7@@2T `P @X d`2E  "A  8?-#/ 2+ ߐ@@ڐ @n@ @.2.@   P # P.2. 2 2 2@`2` . 2 4 `*` "?ߤ## `@@2  `P "`P.?2. @! $! 2 @`2` .  <  p *@ ' p<'2$<􀤠2<㿈'''0  !0<3 j2 2 !d!l2%!<H &l !l@V2a&h !h@M!8?""< 2`@D& & 0? !0<3 *  @1<]"8(cH/`l@2 @    $& 0`@ s  @Z& ,@  @s  p c  & p& & ` &  @e n@2 0x2 0  @ #@ 6@ {@ ~@2 @0 rO@2 @0S2 0- Wb@2 @0k  B@,\\ (LTT(TTTLTLL\\$8,@@,4H@$LpH0㿘H/`<]b8j2/   8 `;& <"*` €@   9b8<2!z!@ƒ  -b8<2! Bm! 8 `. 8 8 <2"_! 8 `. 8 8 . 8@ b8<2"`M!<J"b8* 㿘 ܐ`$& @ 2<n c@z E ̒ @ E< Ab2*  @  . F& l& T. C. I6 ~&! `̄pp`܀ # !  `΄߆ "`܆ <(  ` T0(" T 0 㿘!& & @q <     `?,*` &! ܀ @ <2Ӑ"0V< | D6 ~. C< `<#H*` €<  ܀` ` & <2# B  @ AN ' < T< `G<"*` € ܀ # ?& x "  w z<<r 0t<<z<<#`cxy!t  p U "b L 0] f 0\<2# Ba @ Y <<#Ȓcx U"P # ܀`  E  2 A & 8` & . 8:  7 '5 % ܀  ?& ܑ< 2( <  2#   "  0   0  0@       (ː   D " $  O<H<* C<G   (@& $: @& 4 <3!8z$@ ,  ܀  2< Bِ (@%  "  ܀  p  @  E @ª  D&! . C & l |& T6 ~n < hcxu" 4 , ` H?5 ,  ,  <m2 "aؐ?* 2        # H2  #, |&! D6 ~ . C€㿘  @ 8 "<]8*H*o`0 8 Ho`8j2   8`, 8@ϒ 2 ܀    P`< B @: A`, 2 8 `, 8?<`2 ! B @( A E  @28 4 `$D@`+<#l*` €`' 8 ܐ , 8`  `$ ܐ@ , `@ 8  8 `, 8 @w 8  , 8 `` "@  T  T 2 @`2`  "  B 2  T  T 2 B2㿘<`2!0 B` @' 8 "<]8*H*o`0 8 Ho`8j2% ׀` 8`,8@ 2` ܐ @$`, ",`H` '<3  " ?"  ܐ &   2 ᘒ `$$`8$`4H`8ᘒ"@g- *$`8 1<3`, 4`,1<3! $`4$`8ܒ $`$H€`8! !0@<`H!$`8`H  `,?4`,  ܐ ?$܀`<#*` €"!$0 " B70 T  "T 8 ,80|"! v " Bo  T  "T 8 `,8` "0!" B0 T  "T 8 `,8!` @   " ?" p  2 * ( ` $  " ? "   B B@2 O  2   8 `,8@  㿘 \ <3 ! `"@ `<k0U2 0̀2 0 2 0֝㿘U U@ , 2 p8 "Q  p $ p  @&   `2 % ">   2  &  !6 6 & <    z(  zH/`<ncj2s   " $ < "$ "<c*  㿘 p2`  *@`U& p`  V6` H`<n#j2?  `/ V U  `<` 6  ` " ``2  "  p2  `  2$`<&  "`< -0`ڀ* 2 02 0㿘\``!?`   !<@#H@<cP@6$ $@&&@㿐<n#!˘ #\#`Œ!A2 $ " 22?㿘<n䀣  2``  `@Ʒ  `@ƞ & 㿘 <I" a@"<aH<ђ <n <̐ <n#< a 2"  !'<$2( He   H<#@͐2`DaA4@2@x4`$`4` b @a@$`<aH< <2$㿘  ` d]  .$ dV  & e . && & "N@ @` 2 `.@ `."@``N@ @㿘 ` d?d 0d`J` 2 `` $`J  "``L ` dװ?dՐ0M` . J@,  K@J "` @   L`6` ` `J@J2 ` ` $`J`"`K  ٚ `J` ` $`J  `&@`J@`$`J`  2``* $`㿘 < 2c@    @/< 2-<+<M@@```@<@` : J 3<)<L@`@ ``$L<@`  )<'<M@@w @s``$M@@k(<`0N 0` <"*` < @ @Z N 1<`X @ON 1`<`(@C&㿘 d?d㿘 ` $` !<`!8`%<"+`(`( $ <$`( `2 " $` `2  $` $ <2  @€& `(   `2 @$`$`g`؀ `( "`$ $)$` ` @ 5`ԑ2 `H #<  c W # H2 cO #  #K ޼ 㿘 <a@Ŕ a0@  @ a<a@ `㿘 *<n  2  p2`  @ 6?,`<n #@*` "?F B `P #  `P* @`P2 `$@ *@ ` "W? `  ` M?*`   P2  < * 'a* `2 9?   (   @ D *  ( "(`  $`` @1  ` $` "`# ` ` @ ` "` 㿘 * *<n `2` `p2 @, * @ `(?"(``P2  , `(  ,  @  , c* @ ` $``` @c  ` $` "`<n# ` ` @ ` "` <n  @<D<n " " `@ 㿐!  2   2  p2ڐ < J  ??c<  B <n3` `2  `p@*` *  Ϙ Е* ї* *`   Җ  2 ` +   `+  ";  <ߑ*` D*  #    I ~ @   " ~ 2 @   ~`@      @ "   2  @Ӑ      & < !B @Ѐ$ ~` @    " ~  ~`@  {     q k ̐  p2   ΐ  2  <n 2 2 p * @*` P2` d"PG@60k 2.  <n2 2  p* #* @`  E ( *  ؀  22 `p@ *` c*  *@"@  ΀ <2! B @ Aڐ E<!M @$<n 2 2 p * @*` < "2<`<!Ӓ ) @㿘</<!<],b8# ,`@?`2`<n"#2   ?* 2  (,<_"`, ( " ,  2,<S"<n` 2 2 p * @*`   p`  T 5 P2 / <3 <*b @   # -@H*/ cߔ  T @$ TH/ m@2 3 @,$ T  2 , `2`3  `p@ *` *  ڛ 0<n #`,,    22 p *@ *` ٱ `0 2 ? c, 0"c,$`0@ I,x  ?2 1<n2  c  * *2 * @  .<n #@*` " P0  <ߑ+` `D*  `@ ( U@O3`c d2c䀍`< <":c*`  2c䀍`< <"'c* @`2 `< <" ``<c* @`P2    Ғ u/ /'"& `p2    J`0 @    * 耢 <   <  $$@@  V    "v  n <m!Ȁ`<m!Ā` c䀢e<m!Ȁ`a<m!Ā` ]<#Z c*`    ?#  4 2` / "n$ $@ 2np2 "n J 0` 2 " @\;?n, <5 @ 2` @ը ,2 !6 ~ >6 `n4&݉  <#` 6 ~ @ ~  O L@  < $$@`  $` 2 4 $$ 2/ ~`p2  ") ~ J 0`"$ ~`` <m!Ā` ( ~D  "  ~@ݑ`$@6 ~ 6 ~ ~` 2@ ~  n (3 <m!Ē  <P#<#J #< %< $cB  < 2 $ ~ 8< <  . ~  <  2 A 6 A `" ~@\  ~  Ac* *@/`2c䀍``< Đ "=`<  <`c*`  2c䀍``<  "=`<  <`c*`  2c䀍``<  "=`<  <`c*` ``-`,`` ?#@?` ?#@4=` =`=`<`//////// /=` ` =`/////c*`  ,` . Cc&  &  @<! J 0`+!L #\+6  <n p2    <#<n* c* @` 2 P<f @, 2 2& 27*` c h  @ c @*` c `P;6 "`P   @*` c Pd"P㿘 ?& ` @ÞP<n.`c-`  P2``H/ !<]"8l@2 @  i 'Ő"'?#  /  `*/@Β ,C,,'''$ $<#\aL"؀+,@H*/ Є @sH/ l@2 @$   ΀  䀤y*` P2` `q ΀ m`G< p /@`  *@o/ /,C,,'''$$ฐ <#\aL" +,@H*/  @hH/ l@2c @$<3!,@H*/  d)< !N > Ho`l@2B @ ` <3!?` ,5 ` "<<  * <]?b8#  %/@`  *@/@ ,C,,'''$$ฐ <#\aL ם+,@H*/  @H/ l@2 @$? 䀤7< #\<<<<  `  " < <!  <!0 < !P* c"""P2`  ΀ d"P*  * *` * @ *@ @`"  *  *` *  ""<"! l ,*(%#< Z!`P2 2"< O!@@` #" V ǐ"^<]"8*` `.``5<( <! (*  #@ * @`(  <!, "* @-4` 2  d@ѐ 2@Β +` * $#\  @ * " h2* " d2* " a2 "*`* @`P2 "l ` "h@  /@`   * ///,C,,?'''ؐ#$ $<#\aL"J+<]"8*@H*/ Є @;H/ j@2 @$ < v"P@*` < 2 * @ ` <"<"  ^ #l ݐ*  @@ "j"<]b8*@H*/ 㿘<n# <nc䀢  (*   *<o` $  1<#<o   @!zv`  <"   @  0Ѡ  ,`:  $#䀢 °   * m*  #<*@ *`@%#  b*  <"@͓*`  Y*   $a*`S  <"!`)<oa$" "@ "@  * `<n #<<! a<<8 @*  "@ c @*  "@  : 뀤   ** *  <"`D : ` *` * " * Y/ % |<n#<#<o`|<<ߎ!<n< Dc!X   ,   `| @" " """("$""" """ @ ,,`,  `: 値  :`*` * "  |*    ?" "  :`*` * " *  "? <"ȝ㿘 #<n <]<  # @*` *  * # <#,  "  @*` *  <ɑ* a<" c ,`: #؀` <o |@ ``(`@2`(`c  :`*` * <o|" #ؑ*  "?##ؐc  ?<n%<n, * @ 0c@  *< @`2  <!, :`,  `"@*  * 2 h@ , , * @"c   ȑ, <n#<n c <0 @*      n`2 x @ `: 뀤 㿈N 0  <n! <nc ` *` H P<2  b<#<#(  `2   #\  d 㿘H0  D <n#  @  $?8 $<n # <<o` 6c` 2 c `&+ <#0 * ,@ `*"`"` `  `+``:`*` * " |*   `" 㿘 6 2  p<n. *`   Pb2((<o(< #Pe? |b"P  ? 6. *`  * *`: ` `@*  * 2 z`}/ `|<$"@ἐ"`" (2"Ԥ* `|-  * @"` ?:`*` * " * *`& . @`P ="P㿘. 2 | 㿘<n#<n  dc<o7 Pc `2W`5<o - ? -7<*` * *`: ` `@*  * 2 @z{ | |<"@Ḑ" "@?ܦ`%@ %`%` $, ?@ & $& ``?.`.`:*` * " |*  " `xNj@2 @0ȝl@2 @0k@@2 @0D_@2 @02 @0O@2 @0 CP@2 @0T㿘 ` $` !<`w 0`Ȑ%<"+`(`( $ <$`( `2 " $` `2  $` $ <2  @€& `(   `2 @$`$`X؀ `( "`$ $)$` ` @%` 2 `H #<  c  # H2 c #  #  㿈`*!<n,`2 2   `2 **@ #*`䞬#䀢 X?ba"Tb^5 )b] `94`b_ߐb`r `04`bh"< bbbc `"4`"j "k `4`!?<;  ? # ` @ ''2 ' $`P < `42  `p@*` * ǔ<<. . 6 B<`* g*` D* &ϰ ̰?<;<  ?  &<`* * D* @`& T@ !! `?`**  532 <ڐ#0*`"  ?<;<  ?   `*<ڑ2 c0* @&} @ !! `q?`* k?x `*z 0dT@ !! `*,`2 < S;  <ؒc8- @ `* &0DC?`*9=T@ !! `2<.?;   ? !?,`2  <@  ;@?&02 `p@ *` #* ߃Ri@㿘 ` $` !<`v!8`%<"+`(`( $ <$`( `2 " $` `2  $` $ <2  @€& `(   `2 @$`$``؀ `( "`$ $)$` ` @C`*2 `H #<  c  # H2 c #  #  㿘 !<ߑ* *   H* @` @1(w  *` *  H *  ("( * *  *  `  $`` @ * *   H* @`  $` "<o  ` ` @ ` "`㿘#@E?` !<ߓ* @*`@ H*`  ޫ  ` * *   H* @`P$("P` * *   H* @`P ;2 "P@`  *` *  H *  (@ " ` * *  * "㿘!  =  I  ̀ F ΀   >  Б*  ѓ*` *     2 `$ +  <ߑ* H *  @`"*   < <!ą:  @ *  H* "@ a+( i ~`-   @I,  , @Β@ 2 2  (  "  <"  $2   $$@d  Ҋ($ @    "  ~ "@ w  ~`@  o  `2 8   & < ! F @⼀$ ~` @    " ~?  ~`@  7     - h  ̐  p ΐ `  ` <ߑ* * H * @`PdK"P ` %  <!<!<!ː E <ߑ*` *  H* 2` *@"@0L$  <Ő! <2"8 <2"x B @ Aޙ E<!޶ @_"< * *  H* @`<` "2 ` `=  ``<!ޔ  @=㿘s4 <o  ` * * !<ߐ  H* @` "Q? 2 J?*` *  H *  (`"( * *  *  `  $`` @ޞ * *   H* @`  $` "` ` ` @Ǟ` ` "` . *  H* 2``" @ 㿘<<5<!b <]$X"8c $X`@?`2`<o" 2  "`(<" " $X  2$X<#< * *  H* @`  p`  T 2 P2 , <3 ȑ* @@ `" -H*/ cD Ho`m2  T $ T$ T$X `* *  H* @`(`<3 ȑ* @@ `< @ J(`#8`` $X ` + @ *`@ H*` `)<o `$ $X0  *` * H*  "`<? `dX 0"dX$0` <#` #@?$X㿀  ?<o%    @ # -` @<ߓ*` H@*` 2  P2 `$2  ``2<2   * ! ˰/ (/̐#h A* /6 ~`n <m!Ȁ`<m!Ā` ( ~* `H* @` 2 #/ 2 2`  n 2`  (<   n 6   ?% "@ "*`   ?,2 !6 ~ >u6 2 <#;6 ~  *  e& &<Z#&  ~( ,@5<$$$ $ K $A"" ~ <6# ~<`  ~  2  2  " 40  (  ?* `H* @`2 5 , * `H* @`b:, ?#(`H@M2` `H5554 //////// $8$& &  @5 <#\bt˵+㿘0? <o <`*   2 ` 0 㿘 `0? 8 <o  @ <`$?,#`$  H <В`T 6` 2 &*< ` * H * #`@"`    @ + <t ` 㿘 ?& ` @9pH/ #<]b8l@2 @T". , %<ߠH,    ,@H*/  ?#خ7<H %/@`  *@H/% - C@C '''% H/`l@2T @ #\"t+,@ ؄ @B! H  #= ʮ * H* c# ("_" @ `*` `* @ `*@ *H@*`# ` `*  `*` `*  (#   "+, )$)0* H* @("`* H* *`", H,  <А H @"@ "*`H@*`  *" <!ĕ2"@֒"㿀. * #<ߐ`H* @`P* "PH/ !<]"8l2 ^",H*/  `H/  * ` * ///// @͘ ?2 `H  (" ,`" (͇"0   ` ` * H @& $ ,$$  ` = `*`  $  `< `* ` @  ` <!< Ȓ `  <! <  <!0< #\  <!8< #`  <!H< #d <o2 `* @#h  2   . @* H* (`"(  2 @* H* ( @"(   @* H* (@ "(* H* @`P "P   @* H* (@@"(  2 @* H* (@"(  2 @* H* (@"(  2 @* H* (`"( 2 ?  @, H, @& H@"`0@* H* 0`( "(̣"㿀 <ߑ* *  H* @` ` ڔ  2`J?` ! >` `*` .` ,C4'''$รHo`!<]"8l2e ` #\<Ҙ#t+,` @Rȷ4  ` `@lD㿘<o `P<oa  <<oa,mn <!p  X  $<`H 6    * *  * k.  9$`H  d* !< &$!  \* <`"!  6 Ȗ (*" ` *<ؐ#8" ,  !Y*`$!Ē ` * @*`@`HN*`$`H<amU  $㿐<o<  <Вa<<٢ "#"`@ %<E/<<o#` )<H@ 3,`#@@ @(""Pd"P   9"@ !ē2`"k"02$"" "(@=!@H@y <H@" ` `@ Ơ TH   0  n`0  "`,㿘<o <  0`H<Ш! `2% * 2 }  l q@"`$@$` $ ?@& $&  < ?Ē,,,"ע`Tib@2 0Q]`@2 @0i2 @0X@2 0O2 0H@gcd h,h,h,e(h,h,h,h,h,h,h,h,f㿘 ?# & `" $  @"  $@   aג ~ &  $` @E[㿀  H`#<]b8l2N %<ߑ. * H* @`  ,% Ő 2'?''% H`8l@2# @<֐ #\" +,@ @ ! n% ΐ  "P   <YV<. * H* @` P$"P<"p. I? ? @ ! <" H`l@2 @ ,@0!?<"?2 <" ?  ? ?Ӓ#0А<#X?H`8l2   # R,㿈* @*`<H@*` /  ` *///// 㿈 <ߑ*` *  H*  /` * ////  /    㿘 <ߑ* *  H* @``##  㿘#@2?   㿀%@  ?)`? //@  "  `< * *  H* @` g e  d <߅((H("@ ((( "*` *` h B/ <ߓ* @*`H@*`    *` @///////// J @1 .` 㿘 oD  㿈`.`?#* "*  @ <ߓ* @H*`@*`  />`  *`///  ? h  @?`@ `/<֐"*` €, <`H* *  C/ ȓ*`//////  . ., <ߐ`H* *  C/ *` ///Ȗ  //// *`+  2<* *@ &2` ` ....ё*  ґ* Ӑ *  &, * +<ߐ`H*  /@`   * ///" ! | <q#``H/  N "*`///// *"? \ " .@<#"N `  .` ` .` `  @.` ` .``H/+``////./"%, <`H* *  /   * ///DŽ"     <#ʒ"0,`.`".`.`Ǿ.0 , <`H* *  H/ *// /// ژ ?㿈 @_. <ߒ@ H*`@*`  / `.* >>> /////퀧)$/)0)   / / X x / 㿈. <ߑ* H* @`$  ?8`H<@`# '"`. * `H* @` @В   @*`@`H*` (/  >` `>`* >` //////P 㿘<o!`  ƴ* . ?* <`H* `)$ ?  `?*㿘bb@"#Tba@"ITa bc@bh@".<X "b?<; 3< 2 c0* @&0S@ !! `"H? *  -+2 <ڐ#0*`" ; ;  < 2* c8@ * &0*)?@ !! `2 ? ?j l’  <ߑ* *  H* @`ے窐@2 02 @0؝祐@2 @0*2 0]㿘. <ߑ* `H*   2:$" J0 2<" J Є J2  2 K H@ ` HK " <. * `H* @ "` <LJؐ؀ L J`  L J` ` @ _<J  L   L J@ ` L J@ ` @} @<J  L   L J@ ` L J@ ` @^ !<J!!L   L J@ ` L J@ ` @? 3* `H* (` )"(+`J :`@ ` K J@ ` K J@ ` @   . * `H* @ "` 㿈. <ߑ* H*  @`  h  " ,?@ . @*`@*`H /  `*  / /@>` , , , ,  i H" '"㿈 <ߩ,*`@H*` (`  W Ļ" HP?   A   ,  } "Ò , @H C@/`  @* ///   @ `*  4 ` <!(  ` *  `  `*` ` * ު ܪ  @H /@` *``//   Š `  <!p  `2 `*` 3` *  *@ *  ` `*`@ *# 0*` +`+  " *"@ **    @FH /@` */  ?<!(I{  y `2` `* 3` `*  * * @ ` `* *`# 0* +`+ @ " *" *`* @ 2jԒ(P@H C/   @*`/// _  8 ` H<!//   ` * / ///A   ` ` *  `  `*` * * H* @` <!В  * H*  w"^" d ɐ H@`("`* H* @``(  ' ÿ"z{{{{{{{{{{{{{{{zzzzz{{{{{{{{{{{zz{{ {{${0{<{H{T{`{l{x{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{~~~T~4@LXp|d 8((00000lX l O<݄* <I!<F!<C!<@!<="<:"<7"<4" <1"(<."8<+"@<("P<%"`<""h<"x<"< p<"<"<"< "< "<"<"<!x㿘 "$ $  `  $ $  $ "*" A0R ) N~Ϥ$  $`& & wR $$ $$ ฀ -( *@$@$`*@$@$0 $*@$`( 7$ $㿐 .`  .` .` !#.`$. .`. .`!.`!, * @""`&!`82      &"!  @z&!!!ؐ `2`2  `&!&!.` "`K*`<ސ! € a.`,0E a.`, b. .`00? a . a a .`, b" 2 "  ?   * ``$" b. .`0" 2"  P&!Ȁ  `&!&! a .`, b  * ``$  b . .`0&!<e"` d'v㿐o`   @.` .` vz! `.` `/㿘"`*`<ސ! €1<!1<!1<!1< "1<" 1<"8<,"P㿘   "  & " &@@  @& @L'L'P'T'X@̐Ԕ㿈<''''bh X<b<b ݐ<bِ"` <ސ"*` €<b<b< b< b<b<b<c<<c<c  `$`<ސ"*` €<c0<c8< cH< cP<cX<c`<ch<<c<cx  !<!.@#z``$!<cr<cn /< !*@;` <7<  b %<)<+<  " c "c cؔIE P O@ P  < 6 @`< ,` @ "@㿘`<!̀   2@2 `?2&@ 㿘`~`2``T&``l&`&` @>&aa &`&`&` &` @>` &`㿘`~`2   `Ta@>z`@>v `@("` "` "` "` `@`("`" `" `" 㿘"0   t@ J"(`a&"(&",< ` `A `@&!."V `C ". }  . } . }. } `C`E. & P P  ??( } a  #a#a  a  #a#a  !*@<  P ?( ."Ta  #a#a  (P(O L ` Q S2"H0  2 "PP ? P(PP(O  P&!܀ 2 P2P2PH0 2 2P   ."5."6."V."4."7P  P0&!P  PP 2 H0` 2   ."5."V."4."6  !Д    ."5."6."7."8."V ."4  ."5."6."V."4."7."8P   P&!H1  PH0 2` " 2 `   P? ?( . } `C`E& . a  #a#a   } 2" `C 6 "`E ( `C " 2   P+P   O@2 . "  b  @ " t. +O. +"  b . +0 t"`  + +++8+<+  "@ ~&   ` x ` @0++@ >" @ `$ 2 x ` x `+ 㿘&  x&! \ &   E&! &!2&!"&! $"" $"a 2a"ab, bZ  㿘<x P?㿘 @!< A p!! d㿘",< \\ < V \ \<   O `<`!`H \ " << \A!Pː<;!h"0< \6!p ! +ah㿘< x`!`  `\b,  ,b4 ,bV,bX , <  "b( ?$zMb( "b,")@2!!"$! $!@  $ ! ꀤb,     $   $ 㿘",  $! @&","0 ""(# @$!"0` a&"0 "( ."Z 㿘 \<! ."Z .`  㿘 x   㿘", c&", @$!"( ",  0<|!<<!؁   "", " `  `?* `*  `$  *` ` (  *` +   `$2 *` "*`  *` , (W(Y!  %"!,  "",*`   !a #a#a  $2 ``@8  "?`*@8 ""! ; *@*`*`8*`<` 2 " " *` ` *` "`" "0*@; *` ` $ `2"  /"" *`  㿘", ! $   < \Ð"X  ."4."V  $` ` ` @&0q    $` &  @ |& & && q $?`  ?&& < \"Ő"`  `@`* @!耢#  2 @`* @" @2,`! !"" ! !` ? 2 "  ""! !""   P`3 ! !0 0- P`)` `. ` ``   ! !  .`  ."5  ."V."6."4."7."8 .`  .`   .` !  ,$!$! 6#  \<" \<!" \< " ~  \< @#(  P "P `P ?"`P   "@ $ 쀢`$ < \ܐ#P$ 2# \ ~ "  2    ?$ $ $  $    @,<#p  E p``"   H02 `  㿘",a *a %%   +" `$, ` , `"  ,  (     $a  a < \V# "U ,"T`5,"V"0  D"  D.` ` `   `@!*@@ ``P  `P   ``P ?"`P`a `*` ! `2 \ D.` $a"0 $"0a 2a"a"(  $", <#  0 㿘 \<#< ("(< \ 8  %<#< @`P A! 2 @`",< \ h  #< @`P A! 2 @ؐ`"0< \Ӑ  #< @`P A! 2 @Ő` 㿐" " `  ?"  `@ ?*@ @` `":` &    ?"  `  ` ? `&l "  .` "` `/2``Z .` "0 "0 !  @ 2 A 2 !"# 2 O8 P@2 P O@2 P"  b @  @ "&", P. .` O. .`"  b @ @. .`0&", .` "` @  P.`&!!  ,$!$!  㿘",a ,2%   *" `$, ` , `"  ,  (     $a   " \ .` "`G   $      @&  n    &  @ |$ & && tn $?`  ?&& t `n  t `0  t* t *` t $` t $aa,"Ua ,"D < \ ` 2  t $`$a a  ,$a$a 9 2  \a 2  \a  +$a$a ɔ,<Z  ,"W,"Ya  %$a$a @K<I  ,"V,"X,"4a  ,$a$a  <<!a  ,$a$a @㿘 .` "`  t *` ` *@.@.`#& `$ 2 x!& x?&.` ", * ""," 㿘",< \!(!< !P"0` D" 2"4 D.` "4   <!h  $$ H0<ؐ!,PP,O ?$P  $$ 80 <Ȑ!  $$ -@ 㿘", & ""," @۔㿘", # ""," ^㿘", ( ""," @]㿘 < \!둔  㿘   <o bP* @0w㿘b,b  ` ,`b  `` ` $`x"@2 @"@ &` @ |$`&`&& `m6 $?`  ?&& `  b0 2$a<`\2"$a$b,$! $!b( $b(a 2a"a^Q @ a* aܒ@$aP $P ``<ސ"<*` €<`\! @ ! "?b 2.` b 2 `} P   `   .` `}  & C  E ,`}$` C"@,`!  ,$!$! A2I`\b0  D.` @ a*@@ ) ` "& b4 2" ! "$a!  $a`\< A" @ꥰ ,PP,O $P$b,! $!$! b($!$b(0t  *  <`\ꍐ"@g b <ꀐ"`\<|"< `w  <q  <k!  <e!  <_!  <Y!  @<S!( @ <M!8 "<<G!H<C <?"< `: H<  P```` `<< X `<  h<  p< x< <   <  <   @< @ < Ȁ <  `<`!X``` `2<<!h !x< !<!<!<!Ӑ <ϐ!h`\<ː"``,``,``,```<齐 ``<鷐!``<鱐!``<髐!`` <饐! ` `@<韐!(`@`<限!8`<锐!H钐鐐 `鍐H  P     << X `<  h<  p< x< < j  <d  <^  @<X @ <R Ȁ <M KI ` X    2<<!h !x< !<!<!<!* (!h`\<$"а 㿘 "",   < .` ", %    \ "", ,  "","! 㿘 "D`,"U \<#", ,  "","! 0S `  ` 2 ",", ,"W  $"", "! 0B , "","a "D`<ސ"\*` € "D< \͐#@. ",< \#p @İ 0% } ", C E, $ ", 0", 0", +"a  "T   ", `P*`O "`P*`P㿘P     ."6."V."4."5."7."8P  &P \<&!腐#a  ,&a&a  㿘"H F"G*`沤 @="@9b@,`"@*`" * *  $@-c"  ", @ b @@<#,` , 4<<## \< @I#<#B< `<  (< @ 60",<  \ 0/ @㿘", "F  !"G  "H       ."V."5."6."7."8."4 $!Ԁ ",  ."6."V."4."5."7."8  ,"", "a 0뀤 !؀  "   !@\#, @?` " 145 ,`O!˒@,`P" `2# `P``  14 @" 2 @! `P*@,`P @ b @    b @  * *@ @ . .`0 `P. .` `O. .`"&! `P ,`P,`O. .`. .`" ```   @ b * * @ . .`0`P` $`P \< k X   ."5."V."6."7."8."4!  ,$!$! V !  ,$!$! P B "G "*@&! \< ; <  \ A 4  @ b @   @<  \ 1 $  @ b @  *@ @   . .`0!А   ."V."5."6."7."8."4`P  $`P&!<  \!  !  ,$!$! 㿘", a #!   %" `$, ` , `"  ,  (  n   $a  a *"A "D 7 "W    .` 2 "  `  .` &   ` `a  $$a$a "D "Y`"D "Y * "Y ,"Ya  ,$a$a V ) "W`% "Y `` "D 2  $,"W  a  $$a$a B( ","4 ,"V,"4 .` a  ,$a$a ,"W`  `,  .` a %  a +", )   "%   6 +   t*  # +  (` (@:(`(`8(`< (` " x@" ~"0 (`    + # (`(`  㿘"  &  @ |& & && .`  2", \< !@   , ""," Q *` V"#t  B"qt2 4*` 4  *`  *`2 ~ *`{  4(t 5* 2*` 4  *`  *`2 d  $x"  2o""g t  4*t 5(t 6* t 7( "*` 4  *`  *`2 4  $x"  2o""6   4*t 5(t 6* t 7(t 8* "*` 4  *`  *`2  *` 1, $x"  2o"" *@*` *` , *4 4*` *`  *`2  *` *V *` , 'a  "a, 㿘 "V (4 " . 0fߐ $ =& `$  &  @ |$ & && fĐ $?`  ?&& .` 2/ \" 2.`  + 2" \< 䶐!x "V` .` ", &  "","! 0- " "6` 2 "6",  `P2 "6 .`  "6< 䕐!  "6 2 "4 "8 "$! "4,"V",,"T  ,"","a 㿘",<  \! s 㿘", 0! `  ` <obp* @0ݒ0ڒ㿘   "  . `", $.  .  @ <  \:!`<  \"  <  \,"Xy  "` .  (  ` "0  `@` `@ \<  "p< ̐"`@<  \"А`L<  \ `@"``P C"`P `ǀ ``< a v4 &<  \ܐ#(+  \%#P<  \Ґ#! `<  \#``a @<  \#  <o"#< ?  ,  \㞐`  ?㿘Ho`<]"8j@2X @<̀ " 2  " "$ @ "@8 2"8*`㿘H/`<]"8l@2& @`    "` @ "@,@    x( *@  䀐2 @02 @0ȠȘȐȈȀx\ִִּ㿘< @!   `   4` d@` ?? d@  2@< !`@ @ 2 ?`<!*` €` 4``4``4``4``4`@4` @ 2@  2` d@ 4d@d@@  ? d ? d@ 2 < ⦐! #%? `  d   @"? 2 < ⏐! `#` ?ds ? `  2@< z!@ @ ?`<!*` €`6` `6``6``6``6``6@d@ 4d@` ?# @4`  㿈 xl\ k4@r`    4$4d/! 4 4"4B c %%%% % d ` `2< !" 4@ %   4   4   4 4 4 `  ,%##",%4.$    ! 4%4% 4% 4%4%4%4%4%4%4%4%4% ͈       2@ 2@L% "2@ 2@ 2@2@2@` $ *@?%? ? @ *` $% 4@ 77  < $>"P% 077  2$@" $< *"  !777$ $ 777  < $"   777777~  " %$< "u k0M 2%  777 i% 377a  ). 77Y   $.  7 O% 177G   8@. *  77778   ` % 77 , $ kO 㿘% @ % @< $ p  % < $  % @ < $  < $ `N%  2.%< $!`.% 㿘 x`4 e2  < \ii<",`Q< `< p < ː <c t€< a@zd ",`e5 0`8< U 0 ౐ <c t€ 㿘 xd1<`\!< !@+ Ȕd`@}3㿘!?&!x# @2` @:@ `>! E`? &`$ ~ 2 l    +` *`  2  * "2@ 2    * ` 2?3  *@  ? ? *  㿈? x%2`@ @ <&!LcjB+<i%?#2` @@2'b4 %  8,77@* 7@` %"% @* 77 ` %? ? @$%b4 ?%c %2  " < $b",j@㿘x  ,  ` & $< ؐ!@ &!  @@ ,   ,`,` ,`  % 5$< % ߽!@ &! ,@  @@ ,`,@ @,` A,`  C4` 4`   P`@  @* @  `<3a"  @* a"@ a 4`  @a*`"  4`  E  * 2` `  @ 4`  4` C`@ E ~ I$? @* 4` l`    ?  " " `8  @, ,@ ` * *  * * "     $  " " `4 @$`< /!?$  T@* l& $`  T $`$4`$`, "  @ *`  " 5%  $ "@,*"  5n%h  &!@ 㿘 `& <!*` € ab  d h@@2        <  !hђ  * >㿘H`<]b8j2d  1<"4t  k  5$@ " @4 @  @@@ $5 "H$, *` "  ?* 2     "  $ @`̒ @   k$a$a`~` @)` `@ `T@)` `@ * " 5 `@2$ 2"4b8*㿘Ho`<]"8j@2 @` `j4@ "`@4 @  @@@ &`4 `"H&``, `*` "  ?* 2     "  &` @`̒ @&   dސ$a$a`~`d @)(` `@d `T@)!` `@` * " 4`@2`&`8*`㿈<  @! Aݪ x` 2`!耢  !  + @2  @  A* 3 7777  < @< ݀!Ф ` 2`㿈< `xt!  2`7%7k  @" < ^"    2`2 02 @0&   @,4t,,@Th|T  p  d d d d d  d d d d d d d d d d d dX dx   < d d d d d ddHHhT4)**4*T*t㿘<o@`  4#2`< R"P(? "?  %<o?Lh 2  < ="x @[,h  2  4 7& 4 2  4 ?& 4  2  4 ?& 4  2  4 ?& 4  2  4 ?& 4 2 $ ?$ $ 2 ( ?$ ( 2 , =$ , 2 0 >$ 0 2 < ;$ < 2`*@$`<o ?$`& 8` `$`@` 4* `:`*`  $`<o#`<o@` 4* ` <o` ?`  $`<o# ` <o` ?`  $`<o#$` ` ?`@  $` <o< "ۤ`$<oc( $`"c(㿘<o #2`< ے"Ѐ <o'?#(    2 `?"`"( 8c" 8< "i$ <o(`* ` 0 ```` 2``*0 ((?`` 2` 㿘<o#` *< 5# , ͑2  2`0?퀊  `4 * 2`$$?`$@   @€ @   $  <  #@ $I4`㿀<o#`< #pa'€c`< # O c 2< ؐ#  4* `c  c 2< ǐ#€ c ?< ں ? ?< ڲ 8?€? c < ڢ pc s?< ڛ n?  < ړ ؀ "c?@R  c X?< ڀ!S? c  @c 2< < q! < `m!H@? < f!xc 2< _! €c`< !S  c 2#< < J"<   4* `c    €c`2c< 3"8c < "P< *"x `4*     €c`< "㿀#<oc <  "  @"n `_%€c`< # Rc 2< #  4* `  c 2`< ܐ#`€ c :?< " 3?< #`€?  c $?<  pٸ?  ?< ٮ#P?c 2< ٥ ؐ@i 䀢 ? 㿘 *0<oc < ي#x ?$    2 < #z $ 2 `4 <o#`2  2`< g#`€     ``$@2` `@  . 2 JiX) "L      4* ``€  h ȡ,  @ < ///<€㻐<o#`2 8< # 80@ ڒ  .` 2``  㻐<o#` < &  "h<o#`2 8< H 80@`! Ȑ @+  /Ȁ`  / 80@ /Ѐ`*@.` & 8//`<€㻐<o#`2<ح p  4* `!0?Ӑ#@  `& ?%i " ` <o#`##@ ?@"  `&  㿘  `*@   4@ * ` c€ "    $   `* @$ 㿘. 2 `   `4*@  ̒ 㿀<o#`&@&`&`&` &`<-  4*@!2,Q&`c ?2G&` D&`  3/%</ ,c  •  ` &`2@`  &`  &@` &`c    $c  <`  `@`㿘@ $`2*`"  * ?@*`  *" & K@z̐. @{~ K  <@zĐ. @{v <..@㿘@ ,`@& & *`  ** <*   " * *`  * *       "  * H@O  @` ;<!*` €<o#`2@<S!(@ 2` ``<€ '0@2 * * <o#`2@<8!P@ 2` ``<€  `O<o#`2@<!!x@ 2` ``<€ `@}U  <o#`2@<!@ 2` `g`` :`:`:`////`<€  ` 2*@ * 2 `*`+ 2  ** &` `@}  <o#`2@<А!@ 2`0 ``<€ @ * * @&@<o#`2@<ֳ"@2` `*  /` @|`<€  ~.@<o#`2@<֖"0@2` `   /` @|ΐ`<€  b.@ ^.@<o#`2@<v"X@ ?2`֒ `A`<<o#` <f" Ȓ  @~E'`<€ 70@3 *@ *  *   *  &@.` .`<o#`2<8"  ` //`<€ "  0@<$"? P`l?l @ ////`<€ Y,@,``@ @}@<* *@2 *@* <* *` 3 * + @ <*@ *  *   h  *    &*` 2 ? &@  * +`  0 *` + *  * @  ,@(@ $$$ $ ` В `2 @/////`<€  .`.`h(#%  ?ה(@ @   /////<€ ``@{(#Ȑ㾨8 @  //'/`<€ 89*  `&`<#D ?`@{< h("Ւ  '?(@   ////<€  @ `*  h&`<#8? `@{S`#n㿘@`!<<!@*` €Ni #x?㿘 @|Ð`.`2` Z.@.`.`.` <€㿘@| ` @| ` U`2` .`.`.@.` <€㿘 @|`  .@.`.` <€H   B @//ʀ//ː /ː /`<€ Ԓ   .`.@ @ *  p@&@ .` .` .` .` .` .` .` .` 㿘@|K  (>>>? ? .@.`.`.`.`.`.`@yu.`&` <€㿘 @|.> / >>>>.@.`.`.`.`.`.`.`.`@yVi$&`i0i   .`  .`  X x .`  <€㻀 *? `(a<!*` €<o#`<#`4 ˰?<;  @    2? ِ /` € 2 <@    ?  <ǐ# <o#`2<ӽ   4* ? ~?<o#`y`€ q`€ k<o#`2<ӗ   4* `T`€ W<o#`2<Ӄ H  4* `@<o#`D?  ?$  ?`  $ <o#`2<e p  4* " #2  ? 2.  <o#`<< " " 2    4* `>   4* @? >  <o#`2 <  > **  $ ձ> <o#`2<   4* ``€<o#`<!  4* `   (` ?`€ <ΐ!8T@ !! `Y<o#`2<ҵ!h  4* bz?`(@u<o#`2<!<!<!ҙ   4* `\? @ <o"#2`T@ !! `2`D?`€>T@ !! `<o/?#` <!<!<!T @ $<o#`2 <H! `4.<o#`<<"`4 @`$€ <; @Q    ?  <"@ <o#`2`4<"h`4(ٰ?  4* `  `€c˰  `€c ?Ԓ<o#`2<"    i   d i  h  g  e<Ѿ" <o#`2 <Ѵ"~ `4 * @?p? `[<!T*` €  4* a^?<;  @    2M? l /`, 2> /<@     4* a ?<;  @r    2?`, 2<@\ р ΐ   4* a?<;  @F   2?  ۰?/`, 2Ұ 1<@#     4* a<o#`2<<#(<; @    2?`,  4* a<o#`2<<Ő#P<; @~    ? {`,s  4* ag<o#`2<<М#x<;  @~    "`,V?O  4* aC<o#`2`,<x#`,( ;<; @~    ,?*   4* a<o#`2<P#Ȑ< `,   4* d2`0?X@x  ,@xȓ>`  ///''mȁȦ , @w?`@ ` <"D*` €#  @  8## @" )  <@")0<( <;  @~    ?O*`" O*  * *O"@ @j it  p'ԲȘ   V  w r<Ԑ@}Քi f<;  @}ǔ    2?  O*`" O*  * *O"@ @j2?`4 .`* * "*   '<   0l, , $, Ԕ@}@"? @4Ȕ )0 .`0 <;  @}h    8?? Đ / * /77TP<f@}B  <o#`2<<#(<; x@}/    ?x G//y|/}/z/{//<o#`2<< <; p@}     ٰ?p Et2 2 s2`u2 ///////8@ <o#`2<<κ (<;  h@|ؔ    ? ''Ԑ  8 $8 @ `'ؐ  #@2H-2   /h  /i  /j /k<jd'Ԑ   f-2 @  h , @ i @ , @j ,@ k , 'K<o#`<D H#@`?  ///<o#`<1 x#@`? K// <€" `4* o(  <o#`2<< <;  @|.( ( ^?0 <@|( ( 2?G0 `4* 1<o#`2<<֐ <;  8@{    İ?V < `4* <o?#`2<<ͥ <;  Ȓ@{Ô ,  , ?Ԁ@ `'Ԁ<@ <<!@  <!0y?0v@<q!Hn?     'b?@{ <€  Ԑ@{{؀< @{p @  @ 2?0<<o#`'0<6!`, 02 @ؒ -<;   <o#`',<!, ,2 @h <;   @{5    ? ?h. 2  O?#@2  R /////`<€  `/'`<€h. q2  $'  Q//'`<€ @  $'ؐ $'ې/`<€@. 6 J 4*@@ 6?@2Ȓ . ˦Ƒ*    ! @ ?, 2`     @`&@?" &@   // ,c耢   &@P. 6  4* @ )tЀ %,֑ۢ* @ ? ,@ ?*`2`1   ,  &@,2 q 2&@@  &@㿘<߀`  L@`<' <a@h<a@h<oc( @  +<'< $@h  @<@hb#(  @'< @hz  @<@hrb#(  @'< @hi  @<@hab0#( @'<`4 * @hT   @<@hLbH#( @'<`4 * 2@h>   @<@h6b`#( @'<`4 * 2@h(   @<@h bx#( @'<`4 * 2@h   @<@h b#( @'<`4 * 2@g   @<@gb#( @'<`4 * 2@g   @<@gޒb#( @'<`4 * 2@gД   @<@gȒb#( @'<`4 * 2@g   @<@gb#( @'<`4 * 2@g   @<@gc#( @'<`4 * 2 @g   @<@gc#( @'<`4 * 2@gx   @<@gpc0#( @'<`4 * 2@gb   @<@gZc@#( @'<`4 * 2@gL   @<@gDcX#( @'<`4 * 2@g6   @cp   cp,*`*`꽘<o(`V<o<o<o<o $ @`4* ``"`@`4*``"`@`4*` ``"```@"``` 㿘 `>:  $$?`.< *` €< 4$<o!"#< 8<o"#< <<o"#< @ <o "# < D<o"#$_㿘%<pP  !<p   <o` <<oc< #"8$`<o<o<oc<  $ L$P"#"#"#"#"#<pT 2 2 2<pT 2 2 `2`<pT``2` 㿘` `|D 㿘` `|H 㿘` `|P 㿘` `| 㿘. `` |2㿘` `| 㿐 ϔ`2 < #E ` 7ْ  ` <  1   @    ?a?  @B 8?2; a(; ??㿈  ` ,T @  !! `!  @ @  r : @ 8"@<;@ d?ꀌ`   `{.@``?`   `{?# @ `*`2 @6@``? ?# `{?  **` 2 2 &@?` `   `{a?# @ `*`2 @6@``?   `{@.@`<`>㿘  ` ,@ `  p 8!!!"<;@ `?ꀌ   @ {s` ? ``@?#  2 * {x ` `?#@ ?*` * 2 2 { `` ``@?#  2 * {L ` ` @  {%  < >㿐<p!T 9 $7-</< ` ,(@dz#\,`@dt``D@dl . @@& @ %@&&@%@44㿈  <a@dC<b<2 $ < 2a @d3 "a  & <p!!","" ?㿘 `"  `< "?`N&  㿘.`6`   @   .  . ː  㿘.6. .`      .  /6 6`  㿐.```”ה?ϐ` ? 8' #* ' GGGGGGGGGGHHHHHGG㿘<bА" ?`  ?<p<pІ?( ? <p<pІ??㿘PP)< @ <q <pb<3!@ $ P㿘 ``< "`-+</<< "`x&+</  <* "`+</)<:<p#@ 0 <x <* "x+</` `<qn <p @nl"L@j+</)<:<<""*b<b "a(H`!</ Pj@2 @#<:aT $aT*@e <"<p b<ba<*  <b# a<) "$a<<p<ޒc@+    `? `"|<p"l  @X <q@ <q    `  <p2`"L(`<p ` @( *y@u $ <q  P  <p"` <3<p!∐@ $ <p6 "L(`  <p@( @u@ *y<p"<` `[<pc @<=b|0RPb|  `@Jy.`: @`0E  A> ` <b|@ 3<bb|<h" @@ *` #. 2       `*  2 <p",  .` €:` b|* @uH``Pj@22 @!T %!T*@㿘<b" #<pb2T! bP "T*@L`"P* "Lb<304 @uH/`<aPj@2 @aD"0#aD*@ 㿘<b"G #<pb < N<3 "T!  P "T*@L`"P* "LN b 04@tԞH/`<aPj@2 @aD"0#aD*@ 㿘<q.` 耦` [ O*`* 㿘n <p"| `f <pHy <p| 0(dž* <pHy <p| 0(dž* 㿘<"Ā U㿘<pJ"y`<p"` a$ @Ґ 0@ 㿘<p"| ` P 0@<pHy <p| 0(dž* <b@<b DHo`</Ph2%<:!T"!T(`㿘<b!<)<b%</'<:a< ?" >N "?%!DH`Pj@2 @T $T*@㿘<b!<`)<b%</'<:a< ?" " " %!DH`Pj@2 @T $T*@㿘<pb`3aTbaP&aT .aL &aP(&aLb<304 @sH`1<!Pn2aD#0"aD.㿘 㿘ِ 㿘`] << <p*"*y <p<p ""pHo`</Ph2l<:T"T(`㿘!<  <!|   2$ 㿘<pI9b㿘@_㿘.``  `<p"Г*` €㿘<d!㿘.``.3<pbx !<p@< <p"bH`</ Pj2 <:!T@ #!T*<pbp .bx"bp 㿘.`` <q  <p x 2*x*x 㿘<p "x *"x  <k!h <j"h  @  ` `  *`` <b DHo`</Ph2<:!T"!T(`㿘.``  <i"h*` 㿘.``L<p"| `<p "@` b|<q  J  0:b| ` ) &. < ! €           @ 0  0b| G 2` `0<q  J@ b| ` 㿘.`` <p<q"| a J 2`v `㿘<p<bJ"y bA  *.`  <p"|  `**  <p b@   +<p @   *  b@ `b *@#b **@#b b 1<p"t? ?&"t㿘<b<p@  (  ((<pL . ) <b<f<pb@. "L<  >`(`.`6 `82 ? " @)/@?>`"b Ӆ. 㿘.``<p"| `  Z X 0U 㿘.```  ? 1<p"t?`@f` &"t*`` <pHy<p|  ( *<q2 <( ?@?* Ho`</Ph2Y<:T"T(`<ޑ* @`*`<"̄ (  "  `?"`+  ?+ 㿘<b<<ސ#@*`@ ` `@2 <, "ʘ ``( < b` 6 `@   `` 6 `` @ " `  ``@ "  *  2<p"`2<q a @ !<p<q*!#*a€ #@㿘<p#@ 㿘KJM<q!Ӑ <p#@ ` <3!@$ 0#@ K㿘<``  ? u#"@< <##6 < `* `"  2  # `# < "<\ <  !㿐< <` '\' $@?0?< H`<9#D@ph`  '# &#D`@  !`@ !H`#D@oh` `2"`&#D@@+`@&<"%;< *`@@nW      $ `  ?"@$` &㿘<A  㿘< `"<_< <`􀢀 A 㿈 Z#@ @"8< Z#@"@"A<Q< @@8<0H @"'<  (@" <)@<07@O @*<00<; )< &, ;   &$ ; ?` ?<;  < & <;  ?`<b!<<p`"l <p""l<b!<<bl#@*  ` `?@*<; ? ``"<c` ` ?0ڰ?ꀤ` <p# @0<c# € ˰ # € Ű <; ?`2 `2 `2 <b!<4`<p<ޔ *#@"b  <; <b<<ސ#@*`@ ` `@2 <- "ʘ ``( < b` 6 `@   `` 6 `` @ " ` 6  ``@ "  `* ` `2<p"`2.X <p<pb "`/@b d//<; @l    =?; ; <  ? 1? @l֔ 逢`2&?ꀢ`<p""@bk d<p"b<p""`<<;  "  " &  ?"h? <q<J`  <b?<<" *`  㿘<qa? "a<pl <ޒc@*  ?*<* "l?D  2 @0【2 @0ɀ2 @02 @0D20ր2 @02 @0'20\202 0倐20D20<(`, *`@ "`0 "`4"`8 "`<"(<,(`?<,0 *  , 㿘<! ( , '  0* $ ( $ `$  YΒ   !㿘<v d )`i`""@2$ !"@u㿘`<v `1<v    & &`3<v` <v  `" <v <#@&` 㿈 ]ѐ ̲ <a Ƣ  E2  *  ` " .    <0A"/  E<0: 8 `**. : `*": `*" . : @ "?&?a a `" *`. : @ " &?a a" * 8#pa Ek*`a  2   8 ?* 1: /N -N 0Z @'. # `7'쀊 #" `7'쀊" < #! `7'<##` @ '''ؐa  <cc#7'''ǐ@$  <cc#7'''@`   $`$  X  ݒ !<    (    ?㿘<>$  㿘? <a`? "`"` ?㿐'' P$@?<! H`<9#D@lh`!  '#! $#D !Y  !H`#D@kh` `2"`$#D< a` .@!;  +@jR     & 8< &a`?"`<c@"0>?򀦠   0; <@ ,.@,`  '?",  ; <@ : .@ ` $<a`?"`<#"0㿘<! `"<Z<!` A 㿘 8? ?00   #?0&<;<& <; <` ?<  ( ,?? <  㿘<<#q`㿘<<#i`( 㿘<v t  ?  2㿘<v |@㿘<v ?㿘<<#;`@㿘<<#3`X㿘<<#+`h 㿘<<##`x?㿘<<#`?㿘<v  ?  2㿘<v @㿘<v €㿘<v` 㿘<v €㿘<v @<v" t "tx< <`<< ɒ` b a*`,,<@[Sa<@[`Т  <@\ے 2 <  ? /0'@b @[ @\Ò @b ؒ@[ <@S`@\  @bp ؒ@[ <@Sؒ`  @U@Sޒ ,  @T @SՒ ,  @SВ ,   @T@Sǒ ,i`"4, a,"/,bX`!,)d,#!@, "@",#@%"@ ,  ,,,,,"` - `0` `0- :  n" o e0"ca"`@& $<v"  "㿘<ha  @"a&" )   0@&@ `<i<i Ḱh   <i \\1<i&"d3<j<i` `bh .@ .` .` `d<k h㿘C)C ` ` .  ,; ,; CÐ㿘C)B   ` ` .  ,;n ,;k C㿘<v p`<s!]4<,` €0@V=㿘<v  ɮ<</!P`P @ `,;< ;9  `` r``D  `  `;, N` % <p"8""8"`#<pb8 b8$b8 $  M     0$  d, N`  v $ N`  <b" #N`   kT!AP $T*@L`$P* $L`  @: /` ,@: @:ː  p "`!~` `\ `D` @ L`_':  @ E?0A` `" `a$ 6`` (` @` &` @` ':  @ ?,`: `` /&``:&``h` &`h<v` @hSHo`m2 @ &`"-`H`m@2 / @<:aT "aT-@` ː (```G "`` `D ,:9  :5 ` p ` `:.`"`aT!a0  k$aTaPl `@ `D `  `: N` ) <p"8""8"`#<pb8 b8$b8$  M      $ q$b8$  H0 N`  Z ( N`  <bs`" #N`  Z0KT!!P $T*@L`$P* $L`  @9 ` ,@9 @9  p "`&0<34 @gvHo`m2 k D$0"D-`0`@`\ `D` @  `_'9v  @ ?,`9m &`\` `" `a$ 6``֐ (` @` &` @` '9R  @ ?,`9H `` /&``:&``h` &`h<v` @gHo`m2  &`"-`H`m@2 @<:aT "aT-@`  (z`2`@ ` @8` *@8  tN` "N` N` j ] 0f  ,@8 @8ݐ  V @` `D,8  8Ϡ ` p ` `8`"<`aT!a0  $aTaP*  aP*@` $aP @a0aP* $aPa0<3a4 @f|2`Ho`m2 } D$a0"D-`` 0*@8 0@ࠀ@@㿘<vȀ $Ho`<!Pj2 V "*`    €"` 2 㿘 D  h @f>!  )h `@)ha !)p^ !㿘 D 1㿘<=!@SH㿐 < &    Œ @a & y?@.?{   /8   /8   /7 0  & T*@7   8*7 @  ?Z   . ,@7 ,@7 @       ! h`  . !. . . ,@7͐ ,@7ʐ    ,@7,@7    ! ,7,7   *@7 *7  D`a @e& & @+&  <  & <?א 㿘 < ?> " D  &  D`a @eX < *@& <?㿐 D  ! 4 `  ? # "   < 0 "  0" X "*<v 0@Y)   @ P. ,*& . . #@Y?: . %. &?X. $>    . ,@7/  ,@7+?e= 0 ؓ*  ?>>    }. ,@7  ,@7?K0O P.  @,. + . #@X& ?: . %. &?. $>i    . ,@6  ,@6?) 0 "          ? ` ?  ? `  `@   ? ` @`   ``. . .  @ .   .     .     .     6 d`c4   -@6 @6   -@6 -@6  -@6  0-@6  `/6  ` /6 ` /6{>=N    -@6p  -@6l 0-@6h  @-@6d 6b   -@6] -@6Z     -@6S-@6P     -@6I-@6F    -@6? -@6;  -@66  -@62  -@6-  -@6)  -@6$  -@6   -@6 -@6     -@6-@6   -@6 -@6     -@5-@5   -@5-@5   -@5 -@5  -@5 -@5  -@5 -@5ې  -@5 0-@5Ӑ   -@5ΐ -@5ː   -@5 -@5=㿘< t`==" @  '5  @ ?,`5 =ݐ㿘< `== @  '5  @ ?,`5 =㿘< 5z  , 㿘< `5j   . > 㿘=})<ʦ <0!$@8 4   ,,@5I ,@5F    ,,@5> ,@5;  @ $ @` '5.  @ ?,`5$  o?$$=X㿘)   =+/)B/<v/̄ @bÞ<<;'<v @a0%@% @4@4  @Y;̄ @b @Y,@ o$=$&<4% %@44 `<% 80!$@4   ,,@4 ,@4    ,,@4 ,@4  @ $ @` '4  @ ?,`4  o?$$<)/`, )㿘;)$ $ <=㿘!  ) \ " & \& \;    . ,@4"  ,@4<X` <&?@Z  X; @' p' 4' 8' <' 0' b' d77<@ @`4 <  < ? P`"]?<;@ @` <  < L?@X.!T@ !! ` 0@27? @@22? `@2-? < {ϐ ;π d0$?А& <& X !4 t?ꀢ $& 0? < /В p@& <& X& @& `6 dk㿘:   @3;<;@ ? `&@ 㿘:   @3p;o *``  `2 @`2!`  <;@ ?&@ 㿘<; A?  l@ "`8 m k@`3?ꀦ@" .?`  .  `  .    . ` ?} `".  :    ,3 ,3 ; 㿘 4  !:p     ,@2,@2    ,2 ,2:㿘?#@ )S@T@U@ X@ ! ? @0%@: @o@q=0X@vY@n=0 e@"D< md@0j@K=0s@pk@ m0G* 2hE b  ] *А 2XE~ .*  pJ <; :D?! 4` `&= ; 6?!`  7& (& ߒ'#4[<; @^t! ! ? =㿘!`  ) `  ! @ !$*@&!$㿐):*9w+ ! 2 tt`<"$tt?$t<p"$tt "<:%0  $<!$$$ $$$$$ $<@")!$$$ $$$$$ $) &)d?#@" D   ,,@1 ,@1    ,,@1 ,@1   /1  /1  /1 `" ؟@ ؀`")@)*@&)<ܠc$h$D  @"x Ԁ`"@ @U @!*` Ѐ`"x@x "<` " !i`m !<* $<f !9z㿘)L  Ȑ <*@$ < $ h$ t$ DN !㿐<''  < ?߰>V  2!`$2װ?! @2<|l@2̰?<" @@d@?@! ?"!( h2  H`<9#D@^mh` '&$D8**p t?&t8 x &x8<@88  .,@0  ,@08Ґ8!*G <  !>?7 ,0  0{ `8z<@2`  2>ʞ!H`D@]h` `2"`$D) 2xt &tx ?&x< &< 㿘!V @ <v`* @6u?  <,``p* L `" Df?퀢  <  p(#([? t`$ t&)$ D 2Q " tH 2<v < .<vV  2  !" " " "  " " " " !" " " "  " " " " " W<v!$$" lR"2l!"`H"$l $ |d$ 㿘< @G,#H  @G(<#`,@ ,@㿘'<p# @Qy$ . @Qv ? ,/  ,/<`p # ,/,/ 㿘  *'76  @  '/s  @ ?,`/j  /f   ,/a /^ `7㿘V "<*` p*  N@ 2N@ N@  `㿘<b"  " @$* 2 2 02 @0̀2 02 0􀐠2 @02 0~2 0 @t(@㿘!<) #<v!  #@ <v!*2 )  66K `  ?  `& `*7㿘!<) #<v!  #@ <v!*2 ʔ  66  x   `    & `*6֐㿘`D` `? ` `82 %<p 8` ( `  $8% #<pb8 b8$b8``$  `M      $ $b8$  帒`Β` `Д㿐` `H <</!P`P`  5<3`'`H  ```$ ` "  "!T !T!k!L*``$`!P*`R```$  $ $`$`` $`"` $` "`  $` `P@"`Ld=7` @  $!P *`"1   !P  !P*@ "!P!T4 !P!P!L$!P`$!T$!L *!P!L !T`$!P$!L$!T` ` $2w "`S`   `` "`  ` "` `  "` `` &`` !`  ` !` " ``H "`'`@U`H$@E N*@"$````` `&``*`h<v &`h` @[>Ho`m2 d&`"d-`H`m@2 @<:aT "aT-@2 @"$``  ` &``* t`\` ``*`&`\h&`` ]0`H!$@ 2Y```<``x ``&`*`` /``&`&`&`? 4`4;``h` &`h<v` @ZǞHo`m2 l d&`"d-`H`m@2 [ @<:aT "aT-@`  `` ?` `&``*!` `"l &a㿘<vd $Ho`<!Pj2 ) d"d*`    €"` 2 㿘 H  h @Zi!  )h `@)h !)p !㿘4}  H -  @UZ ?3    " H 2  x H a@Z 0Ԁ  0& x3 <v*ah `* `   *`  * *` *  *` *  *  * @*`   *`  `2 T@ !! `"? H`a @YĞ0 <' c|<( ` @ ,5s T@ !! `o H`a @Ye     *  H  & d! `  & d   d & d d    *` & ` *    H  @Y& & |&&   0 2 8!"d  2  Hp""id  2  H"id    H"id@o    & 3 3㿘  [3u2  w ! 1 x "  & x & `*  d  & d  * H " d! d d ?& d d    * *`  H `a @X <v* ah* `@  *  *` *  *` 2   *`  *@& 3;㿘    H ]!`Y  U`&   0      0             @` ` "`2`  H /G`   ? `# & <v!* %"   0 @`0 @ ! *   @Lj2< `1? H!c' " Ha` @"/ H % !%"  0 0 @ ! *   @L5  @L-a, @*` <@@M}*`@M{@L! <v * @ h& T*`  @L a    "  `  ?h& ` & `  6    ` `& & `*@&  ( *@ &   ` `& & `  c*` H`0 #& La@  /& L H!@ "& P L & L H& P!@ & P H`"   P& P@ & P   P & P119 h*` * `   *  @ `   *` ` *`  *4  * `2   *`  `*    *`1Ր& X㿘)<!`#<v!  @#@ <v!*2    `x 10ڠ`/$`|10 `x* `` o$`1$`|<D` 2a `  `   *@㿘< D `2!  -? # @)`$ 4$<" ! <` $ `  $ `  $ ` $ *# d$  㿘)<!` <v!  @#@ <v!*2 6  ` 0!$@`x 00L```` `$``*1㿘)<! ` <v!  @#@ <v!*2 ˔  2 " `x <`   0`h<v! @VZ /4;  @TȔ "2?1a/`|/`" " 44`x @LƐ `|`@ o$`|0$`&`/`|"@ " 4 4 4<a @U&`@L `|`@ o$`|0x$`&/`|/`" " 44 4`x0b` 0!$@ ``  ` $``*㿘!<)  (<v!  #@ <v!*2 <  "  / , 㿘!<)  8<v!  #@ <v!*2   2  㿘)<!` P<v!  @#@ <v!*2 Ô  //$`$`/$`|)hÒ !)p !!  `@㿘!<)  `<v!  #@ <v!*2      .`:  & \ `   & `*㿘)<!` p<v!  @#@ <v!*2 X  ! "!J! ``d ?$`d/K.`d`` `*/^㿘)<!` <v!  @#@ <v!*2 H  #! " !`\ "J$`\g! ``d $`d/.U`d`` `*/㿘..F  `/4 <@ ; @?&@㿘. g.1  `.,``   2 @ @2 2!  <;@ ?&@㿘<;   ? =  l@ " 8 m k@?01@?0-`d $`d`d $`d`d ?$`d`d ? $`d`d ?`2 @$`d.-͠`d`` `*. 㿘!<)  <v!  #@ <v!*2 }O    .N-  ` @ ` *`.]8)<!` <v!  @#@ <v!*2 G  ??# `S`X`\ `] ! `]?`] `Y`\=0 j   `mߐ`k ܐ#ذӰ-(``'`'`'`'`'`'`'`'`'`'`-' >- `'`'`'`'`'`'`'`'`'`'`-'Ѐ@̀@ Ԁ@Ȁ@Ѐ@ ̀@z @Ԁ@s Ȁ@l ''''''''''',`'`'`'`'`'`'`'`'`'`'`-''<;  &? -< &?  &?  & ?  =㿘!`@ )@ ` @Qݒ` @ ! @ 2``d ?,$`d,5`d`` `*,` @ 2!`! @ "``d$`d!` ! $`d,,`d`` `*,`  ! @ !$*@&!$㿘)`@c<!   <v!   ,+ڤ  ! 2 ```<q $``?$`<`g!$`` "`,0y  $`!$`$`$` $`$`$`$`$` $``@")!$`$`$a $a$a$a $a$a $a) &)`F?#@"``7 ```L ?` $``  $`L` *``T@/ `" ؟@ ؀`")@)* &)`l$`h  $`H`D "` !`D` !`*@$`` !,㿘!<) !8<v!  #@ <v!*2 ˔  3 / <`+ T@E?@F5 <3a   `@@   `@!!``" ᘀ@< !㿘)<!`!P<v!  @#@ <v!*2 x  `*@$``$`h$`$`Hv !㿐''    @" Ѱ>ϰ?T 2`$ǰ?! @pl@" @td@?@ ?"( h2  H`<9#D@Ph` '&$cD**G  ?&+ l `&l**3@  @ ` *`* !g 2` >?@2    ` 2>(!H`cD@P'h` `2"`$cD"l &l ?&l & 㿘!V "@ ,<* `D ` 2`?< $`&)$`H!`a`<v!   #@ <v!*2 wI  "`H`??$``%<$2 * * @"$ Ò @K  t?  0$ `@@"`f`` Z>X? 2S "`J 3<v` /<vV  2``!"`"`"`" `"`"`"`"`!"`"a"a" a"a "a"a"a"  <v"L$" lR"2 l!"`"$ l $`pd$`tx<<'H'Tb@<>   9<< D @*` <v* ah@@!h@  < &c"0㿘< ``"<v8<v#` A ?퀐2 @0ӝ@2020ߝʐ@͐@2020';@20I]@20q@@2 @02 0֝@㿘  `1?<';  )?`  ?槒  &@?@@@   < @ @G @O?㿘 `!8?   &@0?@@ @; " ` <    ? *` " @ *  /$< "@0@?0?㿘  <; @Fɒ  ? # `X?c ?c c`Rc3ca c)c!?.<c{`0c <cH<c񀦀"̀`c<!c򀦀 <"R!?!#@8`"e  "=!#`@8"L@>c `*@`""!l? @9`".@@U  @$ @>: `*@`"!?#@@9 <!`    `#!` "#<c<#<#?# ɖ!!<?# `@9! ??ꀤ`?#!`!#   # @8;@8!?$  "  "@@ Z??# Q? ?M K$ " %"@!{!? Ȳ#@9 !$ " "@#@?4(?!?#@0f "@`! ` "!<@ ?! ` "!< 03??c 㿘 " " @7  @7ǐ  㿘`<! <!     ؒ 2&`  㿘`䔒  `?<; @E   ,&<?00c`Xc# #"<5<0ccj<,!<;  @Dؔ    2%? 䰒  @7Q 쀦@` '?@D  `  '۰?0 ϰ@7C *@@D  <  @D0<;  @Dr    2?. B䰒  @@7' T " '@>w $'  <  <?򰒠5   ?򰒠-@D2  '@D,"; @D"    2o?ޒ h䰒 c찒 @0Y4@8쀦@I?+ )0B<; <(a ( <; @C۔    (?0#@6>'@6'@C  ?" 0 ! ` "!< `?㿘 `X O"8` 27<^!2`7  #"H`  L򀦀/#0# "5` 0< :<*`#%<3!` <! ` <!   ` #? ` 0 ?=<! ` "!<  ???㿘 ♒  <! ""&`X?㿘`X  㿘<1#4= '`@,' ' '  2*@ *` & ' '  2*@ *` &  ' '  ?2*@ *` &  ' ' `& ' '  ?2*@ *` &  ' '  2*@ *` &  ' ' 2*@ *` &  ' `,'㿘<1#4 `, , @8Q*  @7  @, ,  @8A*  @7  @, ,  @81*  @7w  ?@, ,  @8!*  @7g  @, ,  @8*  @7W  ?@, ,  @8* @7G  , ,  8P@7*  @77 @@, ,C??x   ?08!<; @B(    '?% T@ !! `2<?; ؒ@B    ?? <wȀ?  Ȑ <w ȁ 㿘  @Y <3!<w,`"", ~" 㿘<w"<aP<w@ <3!<w < a, @#!,"`#a, "` ~"`㿘< J<,`*@ , <A #<a, D$t!@9Ð`"`"`#`#@``  ``?@G$@H&!H`"$H㿘<* , , a @ ܐ<w!$ $ ܁㿘. * <a* `@ @  2!  *@"2!*@!2!  *@"2!*㿈'D. <*  * a <b<܀!'H'L' ' ,`2'L <b'L<ba<D4$,$ (#<wb<!`   $!<$b "! !`E <"! $!!<<<"!"a" <"!(<!  D"  @2   "    >@ = >4%ԑ, `$* *  4444$ $ "'DD 2J`L "@א`L 2 @ 44<$ $`2 < q!h<w$   26ʀ`"@7*  2`" @7 2  `" @7*  2   @       ?# @ 4 2 @6`L` '@5 O!<$!@7:` `@75!!@71* %`&@   " 6 1 @7* ߏ  )'@7* 2 ?`&?/`2@??` %-.@8- @#/`.`% # "@  ` @@7$  `0  ` @6%`0`@%`@6` 2 `&`2 H`"%`%` @6$@6 @6@6:?$ `@ * }@b%`#(쀣!5`"5`$    `!b5`$*5`"  !,,4<w@2 <!G@` * ? H$쀣 D$`D`"a꽖 @@<ܐ"Г*`   D銒  !<@6*` `@!@6%* @7D!`0  ` @6%`0`@%`UL`<!<w?"a%`4<b<D!<! <wb@5[`  ` @5!<@"$<"! 㿘<*` *  *   Ѐ` <b!,`XU S ꀦ@ 4 @@6  耦 4  @6 <w<w"!$"a   T!" @ $!@? @  Ԁ #"  T!@ @  Ԕ"  &*: @  Ԕ"  <w "a$㿘<*@ *`@ *`!@И <b!,`(<ܓ*"  耢 2 Pꀢ2P<w<w"!$"a  P Ԗ"  @ <w "a$㿘<*@ *`@ *`!@К <b!,`-<ܓ*" %ꀢ2P耣@ 4 P@@6P<w<w"!$"a  P Ԙ#   <w "a$㿘<* @*`@*` 0`@ <!(` @ @*    <!(`" @   ,` .T!2   *2`4 耣@ 4 #@  0H  ,@'<w ꀢ <w`(@ `?7<w! `$( T! @ Ԁ  "   .`4  4 `` 0 0$   T! @ Ԁ  "   <w$("a$㿘<w!(`*<w!$ %? "$!$<b!<<*` *  *  ``" <wR@ " @ <w <a, " $!$㿘<!<a     @4I<( a"@#"(<! <!  <a$"  ,"  aa & #"  @3(a "@$(a <!$ <a"  a  aa   $(asa %a ??j?# ?   @ Va& `:` `Ԙ#  ,`2   & Va`:` `Ԙ#   ɦ & Va`:` `Ԙ#  <!$ <!a " @  <! " ?2 㿘 @3 /`@a ?# @  @ @@ Va$@ `:` `Ԙ#  -`2  `@ $@ Va`:` `Ԙ#  5 Ȩ  `Va$ `:` `Ԙ#  `$ * $%2 㿐@'T<!ؐ`aT"@* ' ܒ` @3 'T`*@@ \*`T @ @?c @  Ԡ&@  <  `- 2  2@ &@   < @ ̲@  $@   : 㿐<-* *   Г2``  `<b!,`2m i<ܐ"Г- 2c  "[ Y  8<! `. @2 @"+<;<'< a@3 ! a$ $!$!!! @ `@ %! %! `2 a<"!<wa 6& ` ``"o `&  Ԛ& #\ @#@  Ԑ`"& &* @"2`@ =`  #\  @ *:`@4"4$@2T$$`|<wH<waD "H"H <w"!L@& #\#@  @ @& #\@ @ & u T"@ *` b&  Z* 2 #@U@`  #\  @ 4 * : "@    #\   " "@4$@1T$ $`|`  <wH<waD "H"H <w"!L@& #\#@  @D @& ##\@ @6 &  $@1_̒T& Ԕ"    @1G @1B 2 ?? &4??    `&``"PT `& Ԛ& #@#\  @ Ԑ`  հ +` &"@2 @#@  #\#@  "@@Ř "*`44$@0T$$`|U<w@{& i ' " @^&  V+` 2 #@Q@@  #\#@  "@@ "* `4Ԑ #\    "    " @4$@0T$ $`|`  <waH" "aH"aH<w`"!L #\   @H@& ##\ @@:  w 0  $@0_ ̒T@ Ԕ"    @0H @0C 2 ?? &4??   㿐<*` *  *   Ѐ`\<b!,`7`4`2 @ @@   耦 4 @ 4T!@6T! 耧 4 T!@6T! T!#\ "@ #`@㿐`@ \@ $@'@-*$@#\#`'@#\#`@ۘ0&'@@#\#`#\#`Ț0V! @@ 6"@  6"  Ԕ#\ 㿘<,@*`@!*`@%< ! <wb-<@. ( 1<@1<!<<"a"$ ` %( @/r!<@"$$ <w!`<ސ!*` <4 ?8@""4?$a! 4!   $  <w <w "@ "D <w *`" "D"D"!D<w<w"!H`"aL`x€   <ܐ"Г, a a? '<b< @$a  4@/  8"@@/ <2  ߌ㿘<* @*`@*`@ `X  ܀`   Ѐ 2J``"K  2 & "C  @. @. 2 @1?8 ! 6 &T!  " @  "   T! @  Ԕ" $@  6 & Ԕ"`  6 &€ 㿘! "&! `" &!? " ΐ?&!& 㿘. * <* a `Ԩ $`  ` K?@ GױC?`a  <!(`@  a"a a 2`!$`$a &`4a4a`$ 625`2`$``"" a`"2 2`" a a?`,a,a4a "` 2  ?" @ 2  ` 2 &?" @ 2  ` 2C+ ``$ ?=!2`$``"" a`"* 2`" a! a` `,a,a4a 2  ?"# " @ *  ` @2 "  &?# @ *  ` *+ ?" @3 &m y` 4a$`@- $`$``@. `` @-`@-:a `?$`a 26``ʀ`"`@-a*  2`a`" `@-` 2`a  `"a @-a*  2 a a`` @  a a    ?# @ 4a `@,Ғ@@,Βߖ a@2 !<! - <wb@,`  ` @-Z!<@"$<"! `a  <ܐ"Г.   `      ?? %?o? x@ s   ư?0`` `?`!b?ꀥ4,,@- Ճ   ϐ???D@$?`$?$?` @ @.``@   ?<!$?  `"`@`"`2`2 `2 ` @3K ``>! - * <* a  &`!&` !`" &` @  @-@/Y$``@  [ - * <`* a  @<;  ? @3X  6/;?@ؖ 24?&` &` ) - * <` a*  0 ? , * * `    &`&` 㿘<(@*`@ *`! @`Ѐ  <<b!,`<2?!0<<aP!p   <w @ * *`1   * 0@  * 3 `` * PP "``P P0` 㿘<b!< 2 #<a( 2  @+1a(   @+͒ &<!<a$ <a" 㿘@ <b@&@ 4 @+@+<ba< <!( #* 3@<b!<@ 2+<!(`%<!1<@ &@ <!!$"@ @ 4`@+Ɛ@*ܐ!$$, @ <!<! "  2&2&0"82$@@ 00 * 2@`<$@<<<@"2㿘<b!<<- * < * a b 2 <ܐ"Г-  2 `<w!`C<ސ!*` <4@ 8@""4!/? !<a@*  a@ ! /<-<"$ $ $@ @,a  &  @*aT?'!Ò o \ <w!D`<wU?!L"`"!L$!L<w!H@4$!L!L "D Ѐ <b!,`2; <ܐ"Г-  23 `/  T@ !L "@  !  >" $  6"  @*t$$`|€!L`2 a  㿘<!(<b!,`*  㿘   00@+i0<; @3B0  <;@ @37㿘 >.`  " b " \  " V  "& P& & & & `&& ҃  & }  & w   &  o  &  ?& && @@  㿘@ @ "@" ` " "@ 8 %*`* , @r`  @k` @d  ``@X㿈 'H   O?  @I5;@ ; H   44%4@`"4<; < 4  @ 4 @  4@  :`4 `  `@  㿘     T?  @:O ` @4 2<; <  *` *` @ 2 *` *` @ @ 2 @*` *`  2   *`*`2   ` ƀ   `@ `   <w " <w"<w"<w"<w<w<w  @ @ 8@ 82@ 2@ 82@ `<w<w<w  @ @ 8@ 82@ 2@ 82@ `<w<w<w$  @ @ 8@ 82@ 2@ 82@ `<w4<w<wTt  @ @ 8@ 82@ 2@ 82@ `JKHL OLLMPOOOOOOOOMNO` H 2? R 2 ! ?㿘<   %< )2@ƒ@ o$&@@ $@P < ` +2 * @`0`D .?Ā  ! :  8"@ `D;<@ @  @12?@B >P < ` +2 * @ 0 D 3?vĀ@  &?:   "@?䀦 D;<@ @ @0Β& @B >?򀦠㿘T &T>`T ?&T<!<` ܠ @ "  L2 `  >a 㿐<'D J@j'<`.`@+ @ 0€ [  0 €. , <, !%<<`*@a!aaa@(yD<%!#4a4a4a4a&$t 2t t&tt`H@DH'aH`"&H H<< a  `J 2' H>?"' H㿈<b@㾐 +<2  `,@ 0`?C?"`3<Q *` €@`  2.<; @/    ?<;  @@/ה   2 ? @  K``2<@/   ? /` 2ܰ<; @/ D  D<; @/    2?` <; @/p    2?` <;  @@/U   2?Ӑ` 2<@/=   r?p<;  @/*    _??`>I< J '<@/ . + <; @/    <? ?'􀢠$*`Ԑ *` ?W !  Q``>  ?€  V` 㾰 < ` +2 * @ 0` ?`$?㿘 +<2 *`   ? 0@€ 㿘 +<2`*`   0 㿘<w"􀢠<C?  #"`)< +<w ``,``2`a,` 6 (,`! ` "@ <  L2  0@€   >$L! "@cD  <w<w"<w<w#%cDC!h  )<0ఐ H   >$H<*` <w"  ??  @2  ̀" " " 㿘 \@%! .- / @$@$@$ @%0C./ - !@@$ے @$Ր!@$А?(@%ɔ0@$ @$"!$@$? @%&$㿘a`@$@$@$`.@ @a &:   /`@2@$.` >`@'1 ?0  ?.`>`@'$ ?㿘a`@$e@$c`/ @a@ @$[aa> >  `.+   `.+    ??<w#H ?2 * ? @@ & *  @@ &㿘`@$+a@$)/`aa: :  `*`/ @  `*`/ @  @)aa@$ `??@<w#H ?2 * ? @@" *  @@"ۺ 㿘! @#@# .`@??@Ö#?@  ""?㿘 * ` @#a  &a:   2`@"`` `` ,< @&] ?``@#` @ ?,< @&H @? ̀2"  0" " 㿘!\  !@#x@#v @!@#q@#o @!@#j@#h@$e0I4$!!@#]@#[  !@#U@#S  !@#M?0@$F 0$@@#; ?@#7 @#1@#.?@#)? @$" $&㿘 "  &`Ҁ` ((a@# `@#`@@@,   @"@"@%?0 @"@"@%0, @"2`?? ?@%`@%`??㿘a@"͒@"``a@"Đ ``Ҙ`(? `` ` 2  28 .`㿘a@"@"``@`Ҧ @h )aa@" `?@?  @`   2 `28 /`??ـ㿘!@"\@"Z  ?@? @ ?8* ? 㿘 "  &`Ҁ` (( a@";`@Va` 6" @"/`@",`  @@"%@$Ԓ?0@"@$ߐ<"p㿘 `"&  P & &   Pw  㿘<Ra@! <Ra<x *@R(*@ @  <@_b0+@<@Vb0"<*b@L20**<bЕ2@C20@ 2*<b<b2@4㿘<R!!< @! T!Ԥ@*<b`@ <x@T!R`() <b<b<*b 2**<b22@@<b*<b2@@&@㿘 ` = & <x<xR(R* `& & !!@@`? "`,<&!`ؐ "` `@`<xR ( ` <xS *  @ S * ՝ 㿘<a`? "`,^!-&! 㿘<xR (??5)<<#H#@+<2   #@* `* `* `* `* < #H* * * * *"`  b@ ??2&㾘<b!,@` ͐<xR`( SN" ?@  <@/ @RԨ `'<Tր h<b@! 4֠5!Ԁh<@cP@<c`@< #h,#h ,  ,  ,  ,  <c`@ !Ԑ`5!ƒ$<"@ 0^? h h< #@#@, ,  ,  ,  ,  <R!Ԩ@'<Tր <b@̖ 4֠5!Ԁ#<$`b @`,` !Ԁ 5!`<`cp@!Ԡ`5!Ԁ` < HH, ,  ,  ,  g$b@W 㿐<b!,`73 㾘<b!,`W<xR`( SR`(` <xR`* 2R`*< c8c8, `,  `,  `,  `,  `,  `,  "$<b"R`*@ @<<`c@B$<N"c@5`'<5<<# #, ,  ,  ,  ,  $ R`( @1@<b@`'<<<# #, ,  ,  ,  ,   㠖, ,  ,  ,  $‖@ 0+`@'<%<@ޖ ` ,? $@ — @@$‖@ 㾐<b!,\`E;@<`2:<  <R!<Ra֔#\<'c`  <R!<Ra֔#\<&c` @M$<"@< 0<@8#؁x؀`-``0&%<P ,@<Sa 0@$ .< 2* + ::0Ԑ3a֒b@G$<"@ ?㿘`<  <" @  㾐<b!, '@'_<x0<xR`* 2  <`\`@@ <c@`$@ '@ 9< '<&g@!<#$ #***** "`'" @' 㠐* * * * '"'"R`* 2  <`` @<<2!֒ 2'v<"'@c 0E@" <c@`@@'@  9< %<& ***** "`'" @9'@ $ٔ0"'"@  ``   㿘<x |  @ `  ?<x|  +` a    @ 2耢`  +``" '@ '0  ??"'<*'0*'1"'@ 㿘`"#'@'<<ܐ"Г*` *'1 <'<*` 'D*  *  &'D@ '`".'0@.'0?&'@ 㿘 @` 6"@\ 㿘 ,/" z?   6@5 'X`  ,  @    ` @$p Ő'X@`'\  08$'`E| 4@̀@ 6'1`27  H  '@  ".'1+  * <a * `@2'|'D<ܐ &'D&'<+  <* a@  €   ?'|`"  '2 2 @ x g`"g@g "-`77`Ґ7g:77g:7g6 7`7g6`Қ#@7g:7`7`7g67g:`֚#@7g6`҄ 7`7g0j @g8`@` ;`g4 , : $:   : :$ ?@,g4"` `: $ @ ?g4`Д`2 `:* `."`?@?@0$g4! $>@ $ `@g4!">@  `@$ g4`Х*`` " `!>@ `@?@㿘 'd`@U 㿘@D D 㿘@=  `  T*` ( <(D2! @2?` 2?` 2?`  2 ?` 2?`` `?  2? ? P<;   Ȓ@$ؔ ,  , ʰ?WȀ c * c * : : : 8Ԁ ?؀ ?< @ @$    ?< @ @$    ?< @ @$    ?`gp ^c6c$@26c < @@$k ^?쀤 e< @@$[ WL?`  @ " Vc? )*@+`  @"  " gl" Vc? *@+`  " @#? "gl@  .b 6b6c 6c6cgh@ 㿘'h" "`€."<3!','@ `&' 㿘`  ``" b0M" b0J b gh,b€,b0B ) 4c! c4c,b$4c4c@!?*`$ !e?* #!<|*$ !ap?* #gp  gl@g6.  ,b4b!`. g: 4c!@g:@4cgh@㿘H <a .<aܔ  <* a* @  @?    |* @?  㿘 .* <* a D  <  *@  $<! <a t .@*`@<!*`@`@0 E`? 㿘 "@ "zg@ "@ "^gh"@"<g"@!"@".<g@ "gt "@m@"gtg "@L "@"?<g<; b@"    | z?!;  ? qgH&&b@"Д  2g?& b&$?&(<gHH H ߑ.@"P ;  ? GE?ꀣ  <`H@"Г*` 9 <; 3?`g2 , g|`(  g0 ""/g2g1 "/g2@/g2  gx`@  /g2;  ?g2& <;<  ? 8? !!"     ? 2ܰ? @   ? 2԰?   ? 2̰?  6.b  ( +@ +`    ?<;<  ? 8? !!"     ? 2? @   ? 2?   ? x? 6gt* & b* @b@*  b@* ` `gt Z W?<;  ? M?c 6c 6G gh C?g@  <`H@"Г*` 6 /b0gh ,?g@ " <`H<@"Г*` <; b@!{    ?gh@   㿘<!*` <*  *  @    <a  `H . * * *` @* *`@!a b .b* *     "@ g" 2  2`@gD  g4g8 * *  &g4&g8- %!@O  㿘 'x` @ '|`@b  *  @  ( @b@* !b@ `* "#b *  2`(b2(b2( 㿘<! .. <*  a* @   <aK gt  * <a ?gt  *`@a*`@ !㿘     <|  ` <| 6  <|` `  2 2   ,``  @ ,@7%2 @:` ,`@/$2 @:`@ ,,`%$ &&  "'  ,"'42$'8'8$'8$'4H  㿘<]!<<ެbЪ! )<  '<b!`Ԁ "#`2```H "`2`g "€  ` `"` 0€p` `>פ " " 㿘`ԧH`j2 `  "  &a: $a "  &a: $a?:?$a#$a$`$`$a a "a/ .@@8.$i4/` $i8$i4  $i`  +㿘ԉH/`h2`?a>'aa:?>'a'a'a'`'`'a 5 'i'i 'i  'i`. 㿘`ԧH`j2x a . a8@  * a@8a@ 4/ `@  a`> $aa> `$a: ?$` 0$a?$a$`$` $a $`А $`$` $`$`a   * $`a  +@㿐`"ԱH/`"j2  a: ?: %!a0?:@ `%!% %!%!% %  %! a/`'4 '8+@a@ "'% А % %  % % aa ` *+**a@ @ @ @aa@u ` @@n @@h @@b,    @*@ *  @@*` % a ```% А % % % % a a a * aa@- `,  `  * % a  * "ЛHo`"h2W*"@* "("`"("`" ("`2""(`"ГHo`"j2* ?   *`㿘"ПH`"n29@'@@9('` ('` ('` '@`('` ('` ('` .bؙH/`bh2 ))e ~" @ @ `b( "Ho`"h2K"  ?RR#RR (??" "(`Ho`"h2""(`Ho`"h2""(`ԙH/`j2u  0` `@"? ‐""""""""  +@ 㿘'8`@Đ&'4`& @&`2 0뀐20B2 02 0߀202 0р20逐2020420Y20n2 0Ho`"h24" *(`Ho`"h2" @*(`㿘'8`@U&'4& `>@&`20ǀ20܈"ЛHo`"h2a: :* * " (+ "#  "(`Ho`"h27" *(`Ho`"h2"" @*(`㿘'8`@ݐ&'4`& @&`2020Ā20"܀"( ? *㿘H/`"j2c '0` "'1 "Ր"* "ЛHo`"h2E*"@* "("`"("`" ("`2""@"(`"ГHo`"j2 ?   *`㿘"ПH`"n29'@@9('` ('` ('` '@`('` ('` ('` '@.bԙH/`bh2 ))e ~" @ @ `b( "Ho`"h2K"  ?RR#RR (??" "(`H`"j@2 @" "@ "" *@H/`"j@2o @"(""@("" *@ 㿘H/`"j2O '0`" "'1 """"""`"" ""@"@ ""* 㿘'8`@M&'4`& @&`2 0202 0䀐2020&20H2 @0m2 @02 0㿘"غH`"h2\/`"/`. @(" `"(㿘'8`@&'4`& @&`㿘"ԻHo`"n2&@((#(`(# .`"ԛHo`"h2  % ~# @ @ `"(`""ԙH/`"j@2 @J"" * 2 2*@ H`bh2 g0  b g1 b"b *b("ГHo`"j2 **`㿘"Ѐ@' 8@ o?ꀦ@"0<j?Ho`"n2w +.`S <1; &"&"& "& H&"&? ; 8?Ho`"h2G`` `?2? 0+` τ +` +``"""(`  2020Հ202 @020;2 0[2020" " 㿘`bbاH`bj2   "  &a: * " a "a/ .@h@d/`?* @$g8.g4@ * @ @ $ b*㿘""ԟH`"h2a>.&       &@&( !  .  ! "(㿘`bbاH`bj2 a"aa .  * @a*  @`/  ab.> `*`%. a?> * %.$$`/ a    * &a   +@㿐`""رH/`"j2K ?a/`:@ `*`#n a: * #n$%a  /a@* `?%/ a/`*`  " " W'aa ` *+**a@ @ @ @aa@V ` @@O @@I @@C,   /`   * @ *  @@*` 'a `` ?%a *` )" a a a * aa@ `,  `  /`  * 'a   ۸ * 㿘    $#꬐    $#? 㿘"УHo`"j2m $֐ "$ " @  * *`  $ `$  $ "*`Ho`"h2>""(`㿘"H`"j2'  `  $#7 `  $# P$` @*@ * @$``*@ * @$`$`"*㿘"H`"h2 # !  .! .  .``   2``.! `.`. ! *@""H/`"k@2 @ # RRR R ( #  0# J" # +@ H`"h2"""`"`(H`"j@2p @" " *@'8'4""`* * "`""ؗH`"j2F ??   " B ? P  # # *2 0တ20$2 0`2 02 0202 0Ԁ202 @0I20r2 @02 0 # <|@ @ `` `#`    ` 2@"  @(*`    @(*`  J" @ J2  @(*`  J" @ J2  @(*` 2 @*  @ "* `* : *`J:`    J  㿘@ؐ.`>`N?:N  H  J"J  J*8" JJ"JJ2J J   JH J*8 H J2  㿘 <} `  N <}" ` Ӑ <}J@ <}*@`" `㿘@Z @U&  @ ?  " ` @ ?2  èDÐød¬ 㿘 <|N 0  N x   #` @ D "  #` D  `   *:  ? *: ?ɀ  @ j   D 2 `2&@ 㿘N -   @Є  J@`"* @ (Є Ё H<`@ < `2 "`   0` `` - ` +`  `  '"`   0`/ `- ``- @ 8@ N ,``@4&?   .  `.   0 . ` 0. ! . ` .   @  0.@ ?`   .`    .  @'HJ@ J@ % @,  H'H ?* : `<n#*` € H А ?H*`:  * H'H`H H?J`.'H А *`H :  * 'H H J h? l LHHJ 'HH @?ۑ* : `Sl <n"*` € ` ,` ,`v  ,` oH` < `   ,   @,` I  , AH 2 l$/"@ %,+  @  %,H J@  @, 'Hl h*`:  bH 'HJ 2J@$,㿘'L'P'T'XL<! 㿘c찠<#d@u㿘 N L왢<!` <#@  |€0#|@hS㿘<`   <"0`@ c!n<#`l€H3:<#`` @ *@` <"0`@ 㿘J<#`t€$0 <x"㿘<!h#<a@4  ? a@ " <؁<<㿘<! < ?#ؔa͐㿘<! <?# @춐㿘<! <?#@쟐㿘}ʠ<! <?#@숐㿘 @5)< ,``*  2     *     @  , @!p, *  *`&   ` @"`㿘 @F ,``*  @2    * @  , <@\!, * *`   ` `@ " # *  *` "` ` @ "` 㿘<!l<s,㿘 !d    &!d\ $0  <a!!dR $<"P @v!@?@ `x@h!@?" @  i*̸  ̸h͈͈hTTΘTДTӔӔН㿘t<!`<s *` €<#`X<#1<!  2?N!?k㿘Iꖢ<!`?<s 4*` €<#ؑ, `\€: <#<*aa?  " 0?R=㿘?* > 㿘. Ǒ> ?X<!`<s L*` €<#`HJ    A 0  %<;<#x@@ 2m < b@ @?LxO@ `OL`@ ` OL`@ ``@ l  <F <b@v @?<J""O  OJ@ ` OJ@ `@ D    <a<b@O @O`J 2J :  Jab   X<!`<s d*` €<#`HJ    = 0S頢<#ذ``xc< b@ @ $<JbOb J`O  J`O  `@ є  k ]#؀ !<JbOb J`O  J`O  `@   2F <a<b@ @<}OJaxaxOJ@ ` OJ@ `@   O J 2J :2 Jab    HJ@   0  㿘!<!'H'L'P'T'X%H !*  `:    @*  `㿘ؠ<!@Ჰ靐㿘?  ` 8 㿘m躠<!@ᔰ㿘?  ` 8 㿘 `?H蕠<!€nY㿘4? ??*w<!` O:㿘!<!ܖ ??!㿘?㿘8@ 㿘?".㿘!<!<b 1`?㿘 <"p#<bД ? m  <bА & .@ <bؔ8|     <8b<3 0?㿘<!`€İ诐㿘  <b1<"㿘  ܐ1<"PN<!` <|#`N "{Nx '@/ *N `'`@`/*@g 2NS @2LN  D "@NN  ,2@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... initTERM=linuxHOME=/scdramfdsdpsdosdnsdmsdlsdksdjsdisdhsdgsdfsdesddsdcsdbsdaloopnfs/dev/bigphysarea=floppy=scsi_logging=max_scsi_luns=ether=kbd-resetconsole=panic=video=noinitrdramdisk_size=ramdisk=prompt_ramdisk=load_ramdisk=ramdisk_start=maxcpus=nosmpprofile=reserve=pci=ip=nfsaddrs=nfsroot=root=Calibrating delay loop... %lu.%02lu BogoMIPS rorwdebugquietinit=<2>initrd overwritten (0x%08lx < 0x%08lx) - disabling it. POSIX conformance testing by UNIFIX linuxrc/dev/console/linuxrc/initrd<3>Change root to /initrd: error %d Warning: unable to open an initial console. /sbin/init/etc/init/bin/init/bin/shNo init found. Try passing init= option to kernel.Linux version 2.2.19 (root@auric) (gcc version 2.95.2 20000220 (Debian GNU/Linux)) #1 SMP Mon Apr 2 13:47:58 EDT 2001 mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... DMA timeout___spinlock_waitfor___rw_read_enter___rw_read_exit___rw_write_enter___atomic_add___atomic_sub___set_bit___clear_bit___change_bit___set_le_bit___clear_le_bit%s[%d]: scall<%d> (could be %d) Aieee: sun4m NMI received! afsr=%08lx afar=%08lx you lose buddy boy... Aieee: sun4d NMI received! %c%08lx%c \|/ ____ \|/ "@'/ ,. \`@" /_| \__/ |_\ \__U_/ %s(%d): %s Caller[%08lx] Instruction DUMP:Unimplemented Sparc TRAP, type = %02lx Whee... Hello Mr. PenguinKernel bad trapKernel illegal instructionPenguin instruction from Penguin mode??!?!KERNEL MNA at pc %08lx npc %08lx called by %08lx BOGUSKernel gets FloatingPenguinUnit disabled trapWARNING: FPU exception from kernel mode. at pc=%08lx Too many Penguin-FPU traps from kernel modePenguin overflow trap from kernel modeTell me what a watchpoint trap is, and I'll then deal with such a beast...mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... machine: %s doesn't have irq handlers defined! %3d: %10u %c %s,%s %s + Trying to free bogus IRQ %d Trying to free free IRQ%d Trying to free free shared IRQ%d Trying to free shared IRQ%d with NULL device ID Attempt to free statically allocated IRQ%d (%s) %s, CPU %d: irq: %d [ %d ] bh: %d [ wait_on_bhwait_on_irqget_irqlockglobal_restore_flags: Bogon flags(%08lx) caller %08lx IO device interrupt, irq = %d PC = %08lx NPC = %08lx FP=%08lx Expecting: [%s:%d:0x%x] AIEEE bogus interrupt receivedTrying to register fast irq when already shared. Trying to register fast irq as shared. request_fast_irq: Trying to register yet already owned. Fast IRQ%d (%s) SA_STATIC_ALLOC failed using kmalloc Attempt to mix fast and slow interrupts on IRQ%d denied Request for IRQ%d (%s) SA_STATIC_ALLOC failed using kmalloc Cannot initialize IRQ's on this Sun machine...mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... sun4m_get_irqmask: IRQ%d has no valid mask! %dobiocounterCannot find /obio/counter node regcounters_percpucounters_systemtimertime_init: unable to attach IRQ%d interruptCannot find /obio/interrupt node interrupts_percpuinterrupts_systemmapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... timertime_init: unable to attach IRQ%d sun4c_interruptsinterrupt-enableCannot find /interrupt-enable noderegmapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... %3d: %10u %c %s,%s %s + Trying to free free IRQ%d Trying to free free shared IRQ%d Trying to free shared IRQ%d with NULL device ID Attempt to free statically allocated IRQ%d (%s) Attempt to mix fast and slow interrupts on IRQ%d denied Request for IRQ%d (%s) SA_STATIC_ALLOC failed using kmalloc All sbus IRQs directed to CPU%d user timertimertime_init: unable to attach IRQ%d Clearing pending IRQs %08x on SBI %d %d%d,%xHalt failed!resetReboot failed!l0: %08lx l1: %08lx l2: %08lx l3: %08lx l4: %08lx l5: %08lx l6: %08lx l7: %08lx i0: %08lx i1: %08lx i2: %08lx i3: %08lx i4: %08lx i5: %08lx fp: %08lx i7: %08lx CPU[%d]: ARGS[%08lx,%08lx,%08lx,%08lx,%08lx,%08lx] FP[%08lx] CALLER[%08lx] sp: %08lx x0: %08lx x1: %08lx x2: %08lx x3: %08lx x4: %08lx x5: %08lx xx: %08lx s%d: %08lx PSR: %08lx PC: %08lx NPC: %08lx Y: %08lx g0: %08lx g1: %08lx g2: %08lx g3: %08lx g4: %08lx g5: %08lx g6: %08lx g7: %08lx o0: %08lx o1: %08lx o2: %08lx o3: %08lx o4: %08lx o5: %08lx sp: %08lx o7: %08lx mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... alloc_io: Mapping outside IOBASE area alloc_io: 0x%lx is already in use alloc_io: cannot occupy %d region alloc_dma: 0x%lx is already in use alloc_dvma: out of dvma memory mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... PROM SYNC COMMAND... Returning to prom KGDB: Entered KGDB: system interrupted OBP: system interrupted boot_flags_init: Halt! Unknown boot switch (-%c) kgdb=ttyKGDB: Using serial line /dev/ttya. KGDB: Using serial line /dev/ttyb. KGDB: Unknown tty line. console=ttyaUsing /dev/ttya as console. ttybUsing /dev/ttyb as console. prommem=%csun4 sun4csun4msun4dsun4esun4uARCH: SUN4 SUN4C SUN4M SUN4D SUN4E SUN4U AP1000 UNKNOWN! <2>initrd extends beyond end of memory (0x%08lx > 0x%08lx) disabling initrd MrCoffee ttya MrCoffee keyboard Inconsistent or unknown console Booted under KADB. Syncing trap table. Breakpoint! cpu : %s fpu : %s promlib : Version %d Revision %d prom : %d.%d type : %s ncpus probed : %d ncpus active : %d undeterminedSun4M OBP based systemSun4m SparcStation5Sun4m SparcStation10/20Sun4m SparcSystem600Sun4c SparcStation IPXSun4c SparcStation ELCSun4c SparcStation 2Sun4c SparcStation SLCSun4c SparcStation 1+Sun4c SparcStation IPCSun4c SparcStation 1Sun 4/400 SeriesSun 4/300 SeriesSun 4/200 SeriesSun 4/100 SeriesTYPE: %s banner-nameIDPROM: Bogus id_machtype value, 0x%x IDPROM: Unknown format type! IDPROM: Checksum failure (nvram=%x, calc=%x)! Ethernet address: %x:%x:%x:%x:%x:%x %s[%d]: Unimplemented SPARC system call %d 0123456789abcdefOKE03E01E02mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... CLOCK: Clock was stopped. Kick start . CLOCK: Kick start still on! CLOCK: Kick start procedure successful. obiocpu-unitbootbusCLOCK: Unsupported architecture! eepromCLOCK: No clock found! modelmk48t02regclock_probe: FAILED! clockmk48t08CLOCK: Unknown model name '%s' <2>NVRAM: Low battery voltage! Something wrong, clock regs not mapped yet. Fujitsu or Weitek on-chip FPUMatsushita MN10501TI MicroSparc on chip FPUSuperSparc on-chip FPUBIT B5010 or B5110/20 or B5210Cypress CY7C602 FPUTexas Instruments TMS390-C602ALsi Logic L64814ROSS HyperSparc combined IU/FPUNo FPUreservedLsi Logic/Meiko L64804 or compatibleWeitek WTL3170/2LSI Logic L64802 or Texas Instruments ACT8847Fujitsu MB86911 or Weitek WTL1164/5 or LSI L64831Fujitsu MB86910 or Weitek WTL1164/5UNKNOWN CPU-VENDOR/TYPEFujitsu or Weitek Power-UPSystems and Processes Engineering Corporation (SPEC)Harvest VLSI Design Center, Inc. - unknownPhilips Corporation - unknownMatsushita - MN10501Texas Instruments, Inc. - unknownTexas Instruments, Inc. - SuperSparc 61Texas Instruments, Inc. - SuperSparc 51Texas Instruments, Inc. - MicroSparc IITexas Instruments, Inc. - MicroSparcTexas Instruments, Inc. - SuperSparc 50LSI Logic Corporation - unknown-typeBipolar Integrated Technology - B5010ROSS HyperSparc RT625 or RT626ROSS HyperSparc RT620Cypress/ROSS CY7C611Cypress/ROSS CY7C601LSI Logic Corporation - L64811Fujitsu TurboSparc MB86907Fujitsu MB86904Fujitsu MB86900/1A or LSI L64831 SparcKIT-40DEBUG: psr.impl = 0x%x psr.vers = 0x%x DEBUG: psr.impl = 0x%x fsr.vers = 0x%x device_typeBooting Linux... cpumidFound CPU %d cpu-unitcpu-idNo CPU nodes found, cannot continue. Found %d CPU prom device tree node(s). mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... nameTadpoleobioclk-ctrlClock Stopping h/w detected... addressenabled (S3) enabled (%s) disabled %s mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... counter14ptrace: bad page directory %08lx ptrace: bad page middle %08lx %s [%d]: Wants to read user offset %ld %s [%d]: Wants to write user offset %ld No solaris handler Impossible unaligned trap. insn=%08x Byte sized unaligned access?!?!<1>Unable to handle kernel NULL pointer dereference in mna handler<1>Unable to handle kernel paging request in mna handler<1> at virtual address %08lx <1>current->mm->context = %08lx <1>current->mm->pgd = %08lx OopsUnsupported unaligned load/store trap for kernel at <%08lx>. Wheee. Kernel does fpu/atomic unaligned load/store.Impossible kernel unaligned trap.User FPU load/store unaligned unsupported. Impossible user unaligned trap.mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... SUNW,JSIIepSUNW,JS-NCSUNW,JS-EJE-1-namePCIC: called twice! pciregPCIC: Error, cannot get PCIC registers from PROM. PCIC RegistersPCIC: Error, cannot map PCIC registers. PCIC IO BasePCIC: Error, cannot map PCIC IO Base. PCI Config Space AddressPCIC: Error, cannot mapPCI Configuration Space Address. PCI Config Space DataPCIC: Error, cannot mapPCI Configuration Space Data. namePCIC: System %s is unknown, cannot route interrupts PCIC MAP: config addr=0x%lx; config data=0x%lx, regs=0x%lx io=0x%lx PCIC: no prom node for device (%x,%x) assigned-addressesPCIC: no "assigned-addresses" for device (%x,%x) PCIC: Skipping I/O space at 0x%x,this will Oops if a driver attaches;device '%s' (%x,%x) PCIC: map window for device '%s' reduced to 2MB ! PCIC: failed to map device '%s' (%x,%x) at %lx PCIC: not mapped device '%s' (%x,%x) ???PCIC: device %s devfn %02x:%02x not found in %d PCIC: BAD PIN %d PCIC: device %s pin %d ivec 0x%x irq %x PCIC: BAD IRQ %d PCIC: setting irq %x for device (%x,%x) PCI: Error, PCIC not found. PCIC: Enabling I/O for device %02x:%02x PCIC: Enabling memory for device %02x:%02x PCIC: BAD PIN %d FOR %s PCIC: dev %s pin %d ivec 0x%x irq %x timertime_init: unable to attach IRQ%d Aiee, NMI pend 0x%x pc 0x%x spec %d, hanging %dPCIC: unimplemented code: FILE=%s LINE=%dpcic.c%s: unimplemented SunOS MAP_NORESERVE mmap() flag %s: Call to sunos_sstk(increment<%d>) is unsupported VA_INVALIDATEVA_SEQUENTIALVA_ABNORMALVA_NORMAL%s: Advises us to use %s paging strategy BOGUSMADV_DONTNEEDMADV_WILLNEEDMADV_SEQUENTIALMADV_RANDOMMADV_NORMAL%s: Advises us to use %s paging strategy for addr<%08lx> len<%08lx> Process makes ni_syscall number %d, register dump: nfsext2iso9660minixufsWarning: UFS filesystem mounts unsupported. procsys_audit FDDI ioctl, returning EOPNOTSUPP Start secondary called. Should not happen CPU[%d]: Returns from cpu_idle! SMP bolixed Cpu%dBogo : %lu.%02lu CPU%d : online Entering SMP Mode... Starting CPU %d at %p Processor %d is stuck. Error: only one Processor found. Total of %d Processors activated (%lu.%02lu BogoMIPS). Yeeee, trying to send SMP msg(%d) on cpu %d Bogon SMP message pass.Entering SMP Mode... Processor %d is stuck. Error: only one Processor found. Total of %d Processors activated (%lu.%02lu BogoMIPS). Yeeee, trying to send SMP msg(%d) to %d on cpu %d Bogon SMP message pass.mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... auxiliary-ioobioauxioregauxiliaryIOpowerpower off control<6>Power off control detected. mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... nameregUGH: property for %s was %d, need < %d fill_ebus_childinterruptsEBUS: dev %s irq %d from parent EBUS: %s got bad irq %d from PROM EBUS: dev %s irq %d from PROM UGH: proplen for %s was %d, need multiple of %d fill_ebus_deviceebus: unable sparc_alloc_io for dev %sEBUS: child %s irq %d from parent EBUS: child %s irq %d from PROM %s: can't find reg property ebus_initThe machine has more banks than this kernel can support Increase the SPARC_PHYS_BANKS setting (currently %d) FAULT: NMI received SREGS: Synchronous Error %08lx Synchronous Vaddr %08lx Asynchronous Error %08lx Asynchronous Vaddr %08lx Memory Parity Error %08lx REGISTER DUMP: <1>Unable to handle kernel NULL pointer dereference<1>Unable to handle kernel paging request at virtual address %08lx <1>tsk->mm->context = %08lx <1>tsk->mm->pgd = %08lx OopsVM: killing process %s Mem-info: Free swap: %6dkB %d pages of RAM %d free pages %d reserved pages %d pages shared %d pages swap cached %ld page tables cached %ld page dirs cached paging_init: Cannot init paging on this Sparc paging_init: sparc_cpu_model = %d paging_init: Halting... Memory: %dk available (%dk kernel code, %dk data, %dk init) [%08lx,%08lx] load_mmu: %d unsupported panic: sparc_init_alloc botch DMA timeoutERROR: out of memory in asyncd MSC bug? setting write request MSC bug? failing request asyncdStarted asyncd mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... Bad pmd in pte_alloc: %08lx Bad pgd in pmd_alloc: %08lx CPU[%d]: Kernel faults at addr=0x%08lx out of mmu contextsHalting now... Wheee, kernel not mapped at all by boot loader. Wheee, kernel not mapped on 16MB physical boundry. Kernel mapped in non-existant memory. Wheee, kernel low mapping overflow. Some bank did not get mapped. [%d]: v[%08lx,%08lx](%lx) p[%08lx] SRMMU: Physical memory is contiguous, bypassing VA<->PA hashes. SRMMU: Compact physical memory. Using strightforward VA<->PA translations. device_typecpummu-nctxSomething wrong, can't find cpu node in paging_init. MMU type : %s invall : %d invmm : %d invrnge : %d invpg : %d contexts : %d Could not determine SRMMU chip type. cache-line-sizecan't determine cache-line-size, halting. cache-nlinescan't determine cache-nlines, halting. No CPU nodes found, halting. SRMMU: Using VAC size of %d bytes, line size %d bytes. ROSS HyperSparcROSS Cypress-604(UP)ROSS Cypress-605(MP)Fujitsu SwiftFujitsu TurboSparcTI TsunamiTI VikingTI Viking/MXCCpsr-implementationpsr-versionmapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... regIOMMU registersCannot map IOMMU registers.Could not allocate iopte of size 0x%08x IOMMU: impl %d vers %d page table at %p of size %d bytes alloc_dvma: Cannot get a dvma page mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... regXPTCannot map External Page Table.iounit_get_area: Couldn't find free iopte slots for (%08lx,%d) alloc_dvma: Cannot get a dvma page iounit_map_dma_init: Couldn't find free iopte slots for %d bytes <3>%s(): keventd has not started current_is_keventdschedule_taskkeventdsignal_queue<2>SIG: sigpending lied <7>eh? notify_parent with state %ld? mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... 840,(bug: kernel timer added twice at %p. <3>schedule_timeout: wrong timeout value %lx from %p Scheduling in interrupt <5>Clock: inserting leap second 23:59:60 UTC <5>Clock: deleting leap second 23:59:59 UTC WTZDSR%-8s %3d current %08lX %5lu %5d %6d %5d %7d %5d sig: %d %s %s : %d X free sibling task PC stack pid father child younger older DMA timeoutcascade%2d: %s Trying to free DMA%d Trying to free free DMA%d uid_cacheCannot create uid taskcount SLAB cache <3>copy_files: pid %d, open files %d exceeds max %d! files_cacheCannot create files cacheLinux<3>No execution domain for personality 0x%02lx <0>Kernel panic: %s <0>In swapper task - not syncing <0>In interrupt handler - not syncing <0>Rebooting in %d seconds..Press L1-A to return to the boot prom ttySttyattyS0ttybttyS1mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... <0>Restarting system. <0>System halted. <0>Power down. <0>Restarting system with command '%s'. <3>init_module: Invalid module header size. <3>A new version of the modutils is likely needed. <3>init_module: Size of initialized module exceeds size of created module. <3>init_module: mod->name out of bounds. <3>init_module: mod->syms out of bounds. <3>init_module: mod->deps out of bounds. <3>init_module: mod->init out of bounds. <3>init_module: mod->cleanup out of bounds. <3>init_module: mod->ex_table_* invalid. <3>init_module: mod->flags invalid. <3>init_module: mod->can_unload out of bounds. <3>init_module: changed module name to `%s' from `%s' <3>init_module: self-referential dependency in mod->deps. <3>init_module: found dependency that is (no longer?) a module. %8lu%4ld (deleted) (autoclean) (unused) (initializing) (uninitialized) [ ] %0*lx %s [%s] %0*lx %s task releasing itself Aiee, killing interrupt handler Attempted to kill the idle task!mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... %04lx-%04lx : %s 4K limit reached! warning: ioport table is full reservedunknownnonedevdebugfsprocnetvmkernelsysrqshmallshmmaxrtsig-maxrtsig-nrmodprobeprintkctrl-alt-delstop-areboot-cmdreal-root-devcap-boundpanicdomainnamehostnameversionosreleaseostypepage-clusterpagetable_cachekswapdpagecachebuffermemovercommit_memorybdflushfreepagesdentry-statedquot-maxdquot-nrsuper-maxsuper-nrfile-maxfile-nrinode-maxinode-stateinode-nr<4>SYSCTL: Can't register %s <1>Help - malformed sysctl tree on free %dPATH=/sbin:/usr/sbin:/bin:/usr/binTERM=linuxHOME=/-s-k<3>kmod: failed to exec %s -s -k %s, errno = %d <3>request_module[%s]: Root fs not mounted <3>kmod: runaway modprobe loop assumed and stopped <3>request_module[%s]: fork failed, errno %d <3>request_module[%s]: waitpid(%d,...) failed, errno %d free_one_pmd: bad directory entry %08lx free_one_pgd: bad directory entry %08lx <3>free_page_tables: Trying to free kernel pgd copy_pmd_range: bad pgd (%08lx) copy_pte_range: bad pmd (%08lx) forget_pte: old mapping existed! zap_pte_range: bad pmd (%08lx) zap_pmd_range: bad pgd (%08lx) put_dirty_page: trying to put page %08lx at %08lx mem_map disagrees with %08lx at %08lx put_dirty_page: pte %08lx already exists do_wp_page: bogus page at address %08lx (%08lx) bad page table directory entry %p:[%lx] find_vma_prev: tree inconsistent with list exit_mmap: map count is %d insert_vm_struct: tree inconsistent with list vm_area_structvma_init: Cannot alloc vm_area_struct cache.mm_structvma_init: Cannot alloc mm_struct cache.filemap_sync_pte_range: bad pmd (%08lx) filemap_sync_pmd_range: bad pgd (%08lx) <3>get_cached_page: page count=%d <3>get_cached_page: page already locked! put_cached_page: page not locked! put_cached_page: page count=%d Page cache hash table entries: %d (order %ld, %ldk) Failed to allocate page hash table change_pte_range: bad pmd (%08lx) change_pmd_range: bad pgd (%08lx) move_one_page: bad source pgd (%08lx) move_one_page: bad source pmd (%08lx) free_area_pte: bad pmd (%08lx) Whee.. Swapped out page in kernel page table free_area_pmd: bad pgd (%08lx) alloc_area_pte: page already exists Trying to vfree() bad address (%p) Trying to vfree() nonexistent vm area (%p) size-131072size-65536size-32768size-16384size-8192size-4096size-2048size-1024size-512size-256size-128size-64size-32kmem_cachekmem_cache_init(): Offsets are wrong - I've been messed with!slab_cachekmem_cache_sizes_init: Error creating caches<3>kmem_create: %sNULL ptr %sCalled during int - %s %sSize too small %d - %s %sSize too large %d - %s %sDecon but no con - %s %sOffset weird %d - %s %sIllgl flg %lX - %s %sForcing size word alignment - %s %sDup name - %s <3>kmem_shrink: NULL ptr <3>kmem_shrink: Called during int - %s <3>kmem_shrink: Invalid cache addr %p <3>kmem_destroy: NULL ptr <3>kmem_destroy: Called during int - %s <3>kmem_destroy: Invalid cache addr %p <3>kmem_destroy: Can't free all objects %p <4>kmem_grow: Illegal flgs %X (correcting) - %s <3>kmem_grow: Called nonatomically from int - %s <3>kmem_alloc: %s (name=%s) unknown<3>kmem_free: %s (objp=%p, name=%s) Bad slab magic (corrupt)NULL ptrfree with no active objsEither bad obj addr or double freefree from inactive slabBad obj addr<3>kmalloc: Size (%lu) too large <3>kfree: Bad obj %p <3>kfree_s: Bad obj %p kmem_cache_reap() called within int! <3>kmem_reap: Corrupted cache struct for %s slabinfo - version: 1.0 %-17s %6lu %6lu DMA timeoutswap_out_pmd: bad pmd (%08lx) swap_out_pgd: bad pgd (%08lx) $Revision: 1.5 $Starting kswapd v%.*s kswapdInternal error: bad swap-device rw_swap_page: weirdness <3>rw_swap_page: Trying to %s unallocated swap (%08lx) readwrite<3>rw_swap_page: Trying to swap to unused swap-device <3>VM: swap page is unlocked swap entry mismatchrw_swap_page: bad swap file <3>rw_swap_page: no swap file or device swap_after_unlock_page: lock already cleared <3>rw_swap_page: page unused while waiting! swap_after_unlock_page: bad swap-device swap_after_unlock_page: weirdness Tried to swap a non-swapper pageVM: swap page is not in swap cache VM: read_swap_page: page already in swap cache! VM: read_swap_page: page already in page cache! VM: rw_swap_page_nolock: page not locked! VM: rw_swap_page_nolock: page in swap cache! DMA timeoutFreeing swap cache page__get_free_pages local_pages list corrupted I__get_free_pages local_pages list corrupted IIFree pages: %6dkB ( Free: %d (%d %d %d) %sDMA: Non%lu*%lukB = %lukB) Swap cache: add %ld, delete %ld, find %ld/%ld <3>swap_cache: replacing non-empty entry %08lx on page %08lx <3>swap_cache: replacing page-cached entry on page %08lx <4>swap_duplicate: entry %08lx map count=%d <3>swap_duplicate: entry %08lx, nonexistent swap file <3>swap_duplicate: entry %08lx, offset exceeds max <3>swap_duplicate at %8p: entry %08lx, unused page <3>swap_count: null entry! <3>swap_count: entry %08lx, nonexistent swap file! <3>swap_count: entry %08lx, offset exceeds max! <3>swap_count at %8p: entry %08lx, unused page! VM: Removing swap cache page with zero inode hash on page %08lx VM: Removing swap cache page with wrong inode hash on page %08lx <3>VM: Found a non-swapper swap page! swap_free: Trying to free nonexistent swap-page swap_free: Trying to free swap from unused swap-device swap_free: offset exceeds max swap_free: swap-space map bad (entry %08lx) unuse_pmd: bad pmd (%08lx) unuse_pgd: bad pgd (%08lx) <3>try_to_unuse: entry %08lx count=%d Filename Type Size Used Priority %-31s file partition %d %d %d Unable to start swapping: out of memory :-) SWAP-SPACESWAPSPACE2Unable to find swap-space signature <4>Unable to handle swap header version %d <4>Swap area shorter than signature indicates <4>Empty swap-file <6>Adding Swap: %dk swap-space (priority %d) bigphysarea: Allocated %d pages at 0x%08lx. bigphysarea_free_pages(0x%08x), not allocated! No big physical area allocated! Big physical area, size %ld kB free list: used list: number of blocks: %8d %8d size of largest block: %8d kB %8d kB total: %8d kB %8d kB chown_common: NULL inode get_unused_fd: slot %d not NULL! VFS: Close: file count is 0 Character devices: %3d %s Block devices: block-major-%dchar-major-%d<7>VFS: Disk change detected on device %s VFS: busy inodes on changed media. %02x:%02xunknown-block%s(%d,%d)unknown-charfilpVFS: Cannot alloc filp SLAB cache.VFS: filp allocation failed VFS: file-max limit %d reached mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... VFS: LRU block list corruptedLRU list corruptedVFS: Free block list corruptedFree list corruptedFree list emptyB_FREE inserted into queuesVFS: buffer LRU pointers corruptedInvalid blocksize passed to set_blocksize<4>set_blocksize: dev %s buffer_dirty %lu size %lu <4>set_blocksize: b_count %d, dev %s, block %lu, from %p Attempt to refile free buffer VFS: brelse: Trying to free free buffer Whoops: end_buffer_io_async: async io complete on unlocked page Whoops: end_buffer_io_async: b_count != 1 on async io. brw_page: page not locked for I/OVFS: grow_buffers: size = %d PROTECTEDDIRTYLOCKEDCLEANBuffer memory: %8ldkB Buffer heads: %6d Buffer blocks: %6d Buffer hashed: %6d %9s: %d buffers, %d used (last=%d), %d locked, %d protected, %d dirty Buffer cache hash table entries: %d (order %d, %ldk) Failed to allocate buffer hash table buffer_headCannot create buffer head SLAB cache Dirty list empty %d kflushdkupdateunknownnone,nodiratime,noatime,mand,sync,nodev,nosuid,noexec,nolock,noac,nocto,tcp,posix,intr,soft%s %s %s %srorwnfs,v%d,rsize=%d,wsize=%d,acregmin=%d,acregmax=%d,acdirmin=%d,acdirmax=%d,addr=%s 0 0 %s %s nodevVFS: empty superblock %p locked! VFS: on device %s: get_fs_type(%s) failed VFS: put_unnamed_dev: freeing unused device %s VFS: mount - already mounted VFS: Busy inodes after unmount. Self-destruct in 5 seconds. Have a nice day... /dev/root/<5>VFS: Mounted root (NFS filesystem)%s. readonly<3>VFS: Unable to mount root fs via NFS, trying floppy. <5>VFS: Insert root floppy and press ENTER VFS: Cannot open root device %s VFS: Mounted root (%s filesystem)%s. VFS: add_vfsmnt failed for root fsVFS: Unable to mount root fs on %s<2>New root is busy. Staying in initrd. change_root: old root has d_count=%d <5>Trying to unmount old root ... okay <3>error %d /dev/root.old<2>Trouble: add_vfsmnt failed binfmt-%04xusr/gnemul/sunos/usr/gnemul/solaris/<3>dupfd: fd %d, max %d kill_fasync: bad magic number in fasync_struct! Attempting to free lock with active wait queueAttempting to free lock with active block list<3>locks_insert_block: remove duplicated lock (pid=%d %ld-%ld type=%d) <4>fcntl_setlk() called by process %d (%s) with broken flock() emulation locks_conflict(): impossible lock type - %d %d:%s %6s %s ACCESSPOSIX MANDATORYADVISORY FLOCK ADVISORY %s READ WRITE%d %s:%ld %ld %ld %08lx %08lx %08lx %08lx %08lx ->unknownnoneEFS: 1.0b - (c) 1999 Al Smith <3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%x/%ld) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! nfsd<2>Negative d_count (%d) for %s/%s /8<4>VFS: moving negative dcache entry (deleted)dentry_cacheCannot create dentry cacheDentry hash table entries: %d (order %d, %ldk) Failed to allocate dcache hash table write_inode_now: no super block <4>grow_inodes: inode-max limit reached grow_inodes: allocation failed <3>iput: inode %s/%ld still has locks! <3>iput: device %s inode %ld still has aliases! <3>iput: device %s inode %ld count changed, count=%d <3>iput: Aieee, semaphore in use inode %s/%ld, count=%d <3>iput: Aieee, atomic write semaphore in use inode %s/%ld, count=%d <3>iput: inode %s/%ld count wrapped <3>free_fd_arrayarray = 0 (num = %d) <3>free_fdsetarray = 0 (num = %d) ELF/usr/lib/libc.so.1/usr/lib/ld.so.1<4>ELF: Ambiguous type, using ELF %d<3>Unable to load interpreter %.128s ELFcore.CORERSDZTDelf_core_dump: file->f_pos (%ld) != offset (%ld) freeundos undo list error id=%d sem_exit undo list error id=%d shm nono: killseg called on unused seg id=%d shm nono: killseg shp->pages=NULL. id=%d shm_open: unused id=%d PANIC ext2_get_group_descblock_group >= groups_count - block_group = %d, groups_count = %luGroup descriptor not loaded - block_group = %d, group_desc = %lu, desc = %luread_block_bitmapCannot read block bitmap - block_group = %d, block_bitmap = %luload_block_bitmapblock_group != block_bitmap_numberext2_free_blocks: nonexistent deviceext2_free_blocksFreeing blocks not in datazone - block = %lu, count = %luFreeing blocks in system zones - Block = %lu, count = %lubit already cleared for block %luext2_new_block: nonexistent deviceext2_new_blockFree blocks count corrupted for block group %dAllocating block in system zone - block = %ubit already set for block %dblock >= blocks count - block_group = %d, block=%dcannot get block %dext2_check_blocks_bitmapSuperblock in group %d is marked freeDescriptor block #%d in group %d is marked freeBlock bitmap for group %d is marked freeInode bitmap for group %d is marked freeBlock #%d of the inode table in group %d is marked freeWrong free blocks count for group %d, stored = %d, counted = %luWrong free blocks count in super block, stored = %lu, counted = %lurec_len is smaller than minimalrec_len % 4 != 0rec_len is too small for name_lendirectory entry across blocksinode out of boundsbad entry in directory #%lu: %s - offset=%lu, inode=%lu, rec_len=%d, name_len=%dext2_readdirdirectory #%lu contains a hole at offset %luext2_file_write: inode = NULL ext2_file_writemode = %07oread_inode_bitmapCannot read inode bitmap - block_group = %lu, inode_bitmap = %luload_inode_bitmapblock_group >= groups_count - block_group = %d, groups_count = %lublock_group != inode_bitmap_numberext2_free_inode: inode has no device ext2_free_inode: inode has count=%d ext2_free_inode: inode has nlink=%d ext2_free_inode: inode on nonexistent device free_inodereserved inode or nonexistent inodeext2_free_inodebit already cleared for inode %luext2_new_inodebit already set for inode %dFree inodes count corrupted in group %dreserved inode or inode > inodes count - block_group = %d,inode=%dext2_check_inodes_bitmapWrong free inodes count in group %d, stored = %d, counted = %luWrong free inodes count in super block, stored = %lu, counted = %luext2_alloc_blockcannot get block %luext2_block_to_pathblock < 0block > bigext2_read_inodebad inode number: %lugroup >= groups countDescriptor not loadedunable to read inode block - inode=%lu, block=%luNew inode has non-zero prealloc count!ext2_write_inodeIO error syncing ext2 inode [%s:%08lx] ext2_find_entryext2_add_entryext2_delete_entry...empty_dirbad directory (dir #%lu) - no data blockbad directory (dir #%lu) - no `.' or `..'ext2_rmdirempty directory has nlink!=2 (%d)ext2_unlinkDeleting nonexistent file (%lu), %dEXT2-fs panic (device %s): %s: %s <2>EXT2-fs error (device %s): %s: %s Remounting filesystem read-only <4>EXT2-fs warning (device %s): %s: %s ,bsddfchecknonenormalstrictEXT2-fs: Invalid check option: %s debugerrorsEXT2-fs: the errors option requires an argument continueremount-ropanicEXT2-fs: Invalid errors option: %s grpidbsdgroupsminixdfnochecknogrpidsysvgroupsresgidEXT2-fs: the resgid option requires an argumentEXT2-fs: Invalid resgid option: %s resuidEXT2-fs: the resuid option requires an argumentEXT2-fs: Invalid resuid option: %s sbEXT2-fs: the sb option requires an argumentEXT2-fs: Invalid sb option: %s grpquotanoquotaquotausrquotaEXT2-fs: Unrecognized mount option %s EXT2-fs warning: revision level too high, forcing read/only mode EXT2-fs warning: mounting unchecked fs, running e2fsck is recommended EXT2-fs warning: mounting fs with errors, running e2fsck is recommended EXT2-fs warning: maximal mount count reached, running e2fsck is recommended EXT2-fs warning: checktime reached, running e2fsck is recommended [EXT II FS %s, %s, bs=%lu, fs=%lu, gc=%lu, bpg=%lu, ipg=%lu, mo=%04lx] 0.5b95/08/09ext2_check_descriptorsBlock bitmap for group %d not in group (block %lu)!Inode bitmap for group %d not in group (block %lu)!Inode table for group %d not in group (block %lu)!EXT2-fs: unable to read superblock VFS: Can't find an ext2 filesystem on dev %s. EXT2-fs: %s: couldn't mount because of unsupported optional features. EXT2-fs: %s: couldn't mount RDWR because of unsupported optional features. EXT2-fs: blocksize too small for device. EXT2-fs: Couldn't read superblock on 2nd try. EXT2-fs: Magic mismatch, very weird ! EXT2-fs: unsupported inode size: %d VFS: Unsupported blocksize on dev %s. EXT2-fs: fragsize %lu != blocksize %lu (not supported yet) EXT2-fs: #blocks per group too big: %lu EXT2-fs: #fragments per group too big: %lu EXT2-fs: #inodes per group too big: %lu EXT2-fs: not enough memory EXT2-fs: unable to read group descriptors EXT2-fs: group descriptors corrupted ! EXT2-fs: get root inode failed ext2trunc_indirectRead failure, inode=%ld, block=%dtrunc_dindirecttrunc_tindirectprocde_put: entry %s already free! de_put: deferred delete of %s ,uidgidproc_iget: using deleted entry %s, count=%d proc_get_inode: inode fubar proc_read_super: get root inode failed /procsysopenpromfsopenprom%dloadavguptimememinfokmsgversioncpuinfoselfkcoremodulesksymsstatdevicespartitionsinterruptsfilesystemsfsdmaioportscmdlinebigphysarealocksmountsswapsprofileslabinfonetscsibus...statusmemcwdrootexefdenvironcmdlinestatstatmmapscpuremove_proc_entry: %s/%s busy, count=%d mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... Bad page dir entry %08lx Bad page middle entry %08lx Bad source page dir entry %08lx Bad source page middle entry %08lx socket:[%lu]pipe:[%lu]..mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... %d.%02d %d.%02d %d.%02d %d/%d %d cpu %u %u %u %lu cpu%d %u %u %u %lu disk %u %u %u %u disk_rio %u %u %u %u disk_wio %u %u %u %u disk_rblk %u %u %u %u disk_wblk %u %u %u %u page %u %u swap %u %u intr %u %u ctxt %u btime %lu processes %lu %lu.%02lu %lu.%02lu total: used: free: shared: buffers: cached: Mem: %8lu %8lu %8lu %8lu %8lu %8lu Swap: %8lu %8lu %8lu MemTotal: %8lu kB MemFree: %8lu kB MemShared: %8lu kB Buffers: %8lu kB Cached: %8lu kB SwapTotal: %8lu kB SwapFree: %8lu kB %s get_phys_addr: pid %d has NULL pgd! bad page directory entry %08lx bad page middle entry %08lx Name: W (paging)T (stopped)Z (zombie)D (disk sleep)S (sleeping)R (running)State: %s Pid: %d PPid: %d Uid: %d %d %d %d Gid: %d %d %d %d Groups: %d VmSize: %8lu kB VmLck: %8lu kB VmRSS: %8lu kB VmData: %8lu kB VmStk: %8lu kB VmExe: %8lu kB VmLib: %8lu kB SigPnd: SigBlk: SigIgn: SigCgt: CapInh: %016x CapPrm: %016x CapEff: %016x %d (%s) %c %d %d %d %d %d %lu %lu %lu %lu %lu %lu %lu %ld %ld %ld %ld %ld %ld %lu %lu %ld %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %d %d statm_pte_range: bad pmd (%08lx) statm_pmd_range: bad pgd (%08lx) %d %d %d %d %d %d %d %08lx-%08lx %s %08lx %s %lucpu %lu %lu cpu%d %lu %lu mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... No low-level scsi modules are currently present %d-%d%dsystem:/dev/ttysystem:consolesystem:vtmastersystemconsoleserial:calloutserialpty:masterpty:slaveptytype:%d.%d%-20s /dev/%-8s %3d %7s %s unknown%-10s %2d ???ttytty/ldisctty/drivertty/ldiscstty/drivers...,norocknojolietunhidecruftutf8iocharsetmapanooffnormalacorncheckrsrelaxedstrictconvbtmabinarytextmtextautoblockmodeuidgid<3>Session %d start %d type %d <3>Invalid session number or type of track CD001<7>ISO 9660 Extensions: Microsoft Joliet Level %d CDROMcp437<7>ISOFS: changing to secondary root <4>isofs_read_super: root inode not initialized <4>isofs_read_super: get root inode failed <4>isofs_read_super: bread failed, dev=%s, iso_blknum=%d, block=%d <4>Bad logical zone size %ld <4>Logical zone size(%d) < hardware blocksize(%u) <4>Unable to identify CD-ROM format. _isofs_bmap: block<0_isofs_bmap: block>= EOF(%d, %ld) isofs_bmap: More than 100 file sections ?!?, aborting... isofs_bmap: ino=%lu block=%d firstext=%u size=%u nextino=%lu <6>ISOFS: unable to read i-node block %lu <6>isofs_read_level3_size: More than 100 file sections ?!?, aborting... isofs_read_level3_size: inode=%lu ino=%lu <6>isofs_read_inode: out of memory <4>Warning: defective cdrom. Enabling "cruft" mount option. Interleaved files not (yet) supported. File unit size != 0 for ISO file (%ld). Warning: defective cdrom (volume sequence number %d). Enabling "cruft" mount option. <4>ISOFS: unable to read i-node block iso9660ARCHIMEDES%3.3x...Unable to read rock-ridge attributes Unsupported NM flag settings (%d) <7>ISO 9660 Extensions: %c Symlink component flag not implemented <4>Attempt to read inode for relocated directory Cannot have symlink with high sierra variant of iso filesystem .../Symlink component flag not implemented (%d) unable to read i-node blocksymlink spans iso9660 blocks unknownnonenfsNFS: put_inode(%x/%ld) NFS: delete_inode(%x/%ld) <5>nfs_get_root: getattr error = %d <5>nfs_read_super: missing data argument <4>nfs warning: mount version %s than kernel oldernewer<4>NFS: mount program passes invalid filehandle! <4>NFS: mount program didn't pass remote address! <5>NFS: cannot create RPC transport. <5>NFS: cannot create RPC client <5>NFS: cannot start rpciod! <5>NFS: cannot retrieve file system info. <5>NFS: cannot initialize writeback cache. <5>NFS: cannot create RPC transport. <5>nfs_statfs: statfs error = %d NFS: nfs_fhget(%s/%s fileid=%Lu) NFS: __nfs_fhget(%x/%Ld ct=%d) <5>__nfs_fhget: iget failed <7>nfs_notify_change: revalidate failed, error=%d NFS: revalidating (%x/%Ld) nfs_revalidate_inode: (%x/%Ld) getattr failed, error=%d nfs_revalidate_inode: (%x/%Ld) refresh failed, error=%d NFS: (%x/%Ld) revalidation complete <3>nfs_refresh_inode: inode or fattr is NULL <3>nfs_refresh_inode: empty inode NFS: refresh_inode(%x/%ld ct=%d info=0x%x) <3>nfs_refresh_inode: inode number mismatch expected (0x%lx%08lx/0x%lx%08lx), got (0x%lx%08lx/0x%lx%08lx) <7>nfs_refresh_inode: inode %ld mode changed, %07o to %07o unknownnonenfs: flush(%x/%ld) nfs: read(%s/%s, %lu@%lu) nfs: mmap(%s/%s) nfs: fsync(%x/%ld) nfs: write(%s/%s(%ld), %lu@%lu) <6>NFS: attempt to write to active swap file! NFS: nfs_lock(f=%4x/%ld, t=%x, fl=%x, r=%ld:%ld) unknownnone<3>NFS: Invalid unlock attempted NFS: nfs_readpage_sync(%p) NFS: nfs_proc_read(%s, (%x/%Ld), %ld, %d, %p) NFS: %4d initiated read call (req %x/%Ld count %d nriov %d. <3>NFS: desynchronized value of nfs_i.nread. NFS: %4d nfs_readpage_result, (status %d) NFS: read (%x/%Ld %d@%ld) NFS: nfs_readpage (%p %ld@%lu) <3>Aiee.. nfs swap-in of page failed! unknownnone<3>NFS: Invalid unlock attempted NFS: nfs_writepage_sync(%x/%Ld %d@%ld) <3>NFS: short write, size=%u, result=%d <3>NFS: unlocked request attempted hashed! <3>NFS: unlocked request attempted unhashed! <3>NFS: desynchronized value of nfs_i.npages. <3>NFS: Add to list failed! <3>NFS: unlocked request attempted added to list! <3>NFS: unlocked request attempted removed from list! NFS: hit soft limit (%d requests) NFS: create_request sleeping (total %d pid %d) NFS: create_request waking up (tot %d pid %d) <3>NFS: Request released while still on a list! <3>NFS: Request released while still hashed! <3>NFS: Request released while still locked! <3>NFS: desynchronized value of nfs_i.ndirty. <3>NFS: desynchronized value of nfs_i.ncommit. NFS: nfs_updatepage(%s/%s %d@%ld, sync=%d) NFS: nfs_updatepage returns %d (isize %ld) NFS: %4d initiated write call (req %x/%Ld count %d nriov %d) NFS: %4d nfs_writeback_done (status %d) <4>NFS: Server wrote less than requested. NFS: faulty NFSv3 server %s: (committed = %d) != (stable = %d) NFS: write (%x/%Ld %d@%Ld), error = %d OK marked for commit NFS: %4d initiated commit call NFS: %4d nfs_commit_done (status %d) NFS: commit (%x/%Ld %d@%ld) mismatch unknownnoneNFS: nfs_readdir_filler() reading cookie %Lu into page %lu. NFS: found cookie %Lu NFS: find_dirent() returns %d NFS: find_dirent_page() searching directory page %ld NFS: find_dirent_page() returns %d NFS: readdir_search_pagecache() searching for cookie %Lu NFS: readdir_search_pagecache() returned %d NFS: nfs_do_filldir() filling starting @ cookie %Lu NFS: nfs_do_filldir() filling ended @ cookie %Lu; returning = %d NFS: uncached_readdir() searching for cookie %Lu NFS: uncached_readdir() returns %d nfs_lookup_validate: %s/%s has dud inode NFS: lookup(%s/%s) NFS: create(%x/%ld, %s NFS: mknod(%x/%ld, %s NFS: mkdir(%x/%ld, %s) NFS: rmdir(%x/%ld, %s NFS: silly-rename(%s/%s, ct=%d) <3>NFS: silly-renaming %s/%s, negative dentry?? .nfs%*.*lx%*.*xtrying to rename %s to %s NFS: safe_remove(%s/%s) <3>nfs_safe_remove: %s/%s already negative?? <6>nfs_safe_remove: %s/%s busy, d_count=%d NFS: unlink(%x/%ld, %s) NFS: symlink(%x/%ld, %s, %s) <4>nfs_proc_symlink: %s/%s not negative! <6>nfs_proc_symlink: %s/%s already exists?? NFS: link(%s/%s -> %s/%s) NFS: rename(%s/%s -> %s/%s, ct=%d) <6>nfs_rename: target %s/%s busy, d_count=%d <6>nfs_rename: new dentry %s/%s busy, d_count=%d unknownnoneunknownnoneNFS call getroot NFS reply getroot NFS call getattr NFS reply getattr NFS call setattr NFS reply setattr NFS call lookup %s NFS reply lookup: %d NFS call readlink NFS reply readlink: %d NFS call read %d @ %ld NFS reply read: %d NFS call write %d @ %ld NFS reply write: %d NFS call create %s NFS reply create: %d NFS call mknod %s NFS reply mknod: %d NFS call remove %s NFS reply remove: %d NFS call rename %s -> %s NFS reply rename: %d NFS call link %s NFS reply link: %d NFS call symlink %s -> %s NFS reply symlink: %d NFS call mkdir %s NFS reply mkdir: %d NFS call rmdir %s NFS reply rmdir: %d NFS call readdir %d NFS reply readdir: %d NFS call statfs NFS reply statfs: %d unknownnone<3>NFS: Bad number of iov's in xdr_readargs <4>NFS: Odd RPC header size in read reply: %d NFS: Short READ header. iovec will be shifted. RPC: readres OK count %d <3>NFS: Bad number of iov's in xdr_writeargs (nr %d max %d) <4>NFS: Odd RPC header size in READDIR reply: %d NFS: Short READDIR header. iovec will be shifted. <3>NFS: Bad result buffer in readdir <4>NFS: giant filename in readdir (len 0x%x)! <5>NFS: short packet in readdir reply! <4>NFS: Odd RPC header size in READLINK reply: %d NFS: Short READLINK header. iovec will be shifted. <3>nfs_stat_to_errno: bad nfs status return value: %d nfs_statfsnfs_readdirnfs_rmdirnfs_mkdirnfs_symlinknfs_linknfs_renamenfs_removenfs_createnfs_writenfs_writecachenfs_readnfs_readlinknfs_lookupnfs_rootnfs_setattrnfs_getattrnfs_nullunknownnonenfs_flushdNFS: writecache_init NFS: reqlist_exit (ptr %p rpc %p) NFS: %4d flushd starting NFS: %4d flushd back to sleep unknownnonenfs_delete_queueunknownnoneacdirmaxacdirminacregmaxacregminretranstimeowsizersizeportbroken_suidtcpudpv3v2nolocklocknoacacnoctoctonoposixposixnointrintrhardsoft,default/tftpboot/%s<3>Root-NFS: Pathname for remote directory too long. <3>Root-NFS: No NFS server available, giving up. <5>Looking up port of RPC %d/%d on %s <3>Root-NFS: Unable to get nfsd port number from server, using default Root-NFS: Portmapper on server returned %d as nfsd port <3>Root-NFS: Unable to get mountd port number from server, using default Root-NFS: mountd port is %d <3>Root-NFS: Server returned error %d while mounting %s unknownnoneNFS: nfs_mount(%08x:%s) mnt_mountmnt_nullmnt3_mountmnt3_nullmountunknownnoneNFS call getroot NFS reply getroot NFS call getattr NFS reply getattr NFS call setattr NFS reply setattr NFS call lookup %s NFS reply lookup: %d NFS call access NFS reply access NFS call readlink NFS reply readlink: %d NFS call read %d @ %ld NFS reply read: %d NFS call write %d @ %ld NFS call create %s NFS reply create: %d NFS call setattr (post-create) NFS reply setattr (post-create): %d NFS call remove %s NFS reply remove: %d NFS call rename %s -> %s NFS reply rename: %d NFS call link %s NFS reply link: %d NFS call symlink %s -> %s NFS reply symlink: %d NFS call mkdir %s NFS reply mkdir: %d NFS call rmdir %s NFS reply rmdir: %d NFS call readdir%s %d plusNFS reply readdir: %d NFS call mknod %s %x NFS reply mknod: %d NFS call fsstat NFS reply statfs: %d unknownnone<3>NFS: Bad number of iov's in xdr_readargs <3>NFS: Bad number of iov's in xdr_writeargs <4>NFS: Odd RPC header size in READDIR reply: %d NFS: Short READDIR header. iovec will be shifted. <4>NFS: giant filename in readdir (len %x)! <4>NFS: giant filehandle in readdir (len %x)! <5>NFS: short packet in readdir reply! NFS: FH truncated <4>NFS: Odd RPC header size in READLINK reply: %d NFS: Short READLINK header. iovec will be shifted. <4>NFS: READ count doesn't match RPC opaque count. <4>NFS: Odd RPC header size in read reply: %d NFS: Short READ header. iovec will be shifted. <4>NFS: server cheating in read reply: count %d > recvd %d nfs3_commitnfs3_pathconfnfs3_fsinfonfs3_fsstatnfs3_readdirplusnfs3_readdirnfs3_linknfs3_renamenfs3_rmdirnfs3_removenfs3_mknodnfs3_symlinknfs3_mkdirnfs3_createnfs3_writenfs3_readnfs3_readlinknfs3_accessnfs3_lookupnfs3_setattrnfs3_getattrnfs3_nullunknownnone<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%x/%ld) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! unknownnone<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%x/%ld) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! <5>lockd: CANCEL call failed (errno %d) <4>lockd: Uh-oh! Interfering reclaims for host %sunknownnone<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%x/%ld) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! %d@%s<5>NFSv4 file locking not implemented! lockd: clnt proc returns %d nlmclnt_alloc_call: failed, waiting for memory lockd: call procedure %s on %s lockd: rpc_call returned error %d lockd: server in grace period <4>lockd: spurious grace period reject?! lockd: server returns status %d lockd: call procedure %s on %s (async) <5>lockd: failed to monitor %s <4>lockd: failed to reclaim lock for pid %d (errno %d, status %d) lockd: unexpected unlock status: %d lockd: unlock failed (err = %d) lockd: CANCEL call error %d, retrying. lockd: cancel status %d (task %d) lockd: CANCEL failed (server has no locks) <5>lockd: weird return %d for CANCEL call <5>lockd: unexpected status NLM_BLOCKED <5>lockd: unexpected server status %d unknownnone<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%x/%ld) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! lockd: attempt to create host entry failed. lockd: creating host entry. %d.%d.%d.%d<5>lockd: no clnt or addr in lookup_host! lockd: nlm_lookup_host(%08x, p=%d, v=%d) lockd: nlm_bind_host(%08x) lockd: next rebind in %ld jiffies lockd: couldn't create RPC handle for %s lockd: rebind host %s lockd: get host %s lockd: release host %s lockd: shutting down host module lockd: nuking all hosts... <4>lockd: couldn't shutdown host module! lockd: %d hosts left: %s (cnt %d use %d exp %ld) lockd: host garbage collection lockd: delete host %s unknownnone<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%x/%ld) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! lockdNFS locking service started (ver 0.4). <4>lockd: terminating on error %d lockd: request from %08x <7>lockd: new process, skipping host shutdown <4>lockd_up: no pid, %d users?? <4>lockd_up: create service failed <4>lockd_up: makesock failed, error=%d <4>lockd_up: create thread failed, error=%d <4>lockd_down: no users! pid=%d <4>lockd_down: no lockd running. <4>lockd_down: lockd failed to exit, clearing pid unknownnone<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%x/%ld) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! lockd: nlmsvc_insert_block(%p, %ld) lockd: nlmsvc_lookup_block f=%p pd=%d %ld-%ld ty=%d lockd: check f=%p pd=%d %ld-%ld ty=%d cookie=%x cookie: head of blocked queue %p, block %p lockd: created block %p... lockd: deleting block %p... lockd: deleting granted lock lockd: unblocking blocked lock lockd: nlmsvc_lock(%04x/%ld, ty=%d, pi=%d, %ld-%ld, bl=%d) lockd: posix_lock_file returned %d lockd: blocking on this lock (allocating). lockd: blocking on this lock. lockd: nlmsvc_testlock(%04x/%ld, ty=%d, %ld-%ld) lockd: conflicting lock(ty=%d, %ld-%ld) somehostlockd: nlmsvc_unlock(%04x/%ld, pi=%d, %ld-%ld) lockd: nlmsvc_cancel(%04x/%ld, pi=%d, %ld-%ld) lockd: VFS unblock notification for block %p <4>lockd: notification for unknown block! lockd: grant blocked lock %p lockd: lock still blocked <4>lockd: unexpected error %d in %s! nlmsvc_grant_blockedlockd: GRANTing blocked lock. lockd: GRANT_MSG RPC callback callback: looking for cookie %x lockd: no block for cookie %x nlmsvc_retry_blocked(%p, when=%ld) nlmsvc_retry_blocked(%p, when=%ld, done=%d) unknownnone<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%x/%ld) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! unknownnone<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%x/%ld) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! <5>lockd: unauthenticated request from (%08x:%d) lockd: NULL called lockd: TEST called test: status before %d lockd: TEST status %d vers %d lockd: LOCK called lockd: LOCK status %d lockd: CANCEL called lockd: CANCEL status %d lockd: UNLOCK called lockd: UNLOCK status %d lockd: GRANTED called lockd: GRANTED status %d lockd: TEST_MSG called lockd: LOCK_MSG called lockd: CANCEL_MSG called lockd: UNLOCK_MSG called lockd: GRANTED_MSG called lockd: SHARE called lockd: SHARE status %d lockd: UNSHARE called lockd: UNSHARE status %d lockd: NM_LOCK called lockd: SM_NOTIFY called <4>lockd: rejected NSM callback from %08x:%d lockd: %4d callback failed (errno = %d) unknownnone<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%x/%ld) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! lockd: nlm_file_lookup(%s/%u) lockd: creating file for %s/%u lockd: open failed (nfserr %d) lockd: found file %p (count %d) lockd: closing file %s/%ld <4>lockd: attempt to release unknown file! lockd: unlock failure in %s:%d svcsubs.clockd: nlm_release_file(%p, ct = %d) lockd: nlmsvc_mark_resources lockd: nlmsvc_free_host_resources <4>lockd: couldn't remove all locks held by %slockd: invalidating client for %s unknownnone<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%x/%ld) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! <7>nsm_mon_unmon: rpc failed, status=%d lockd: nsm_monitor(%s) <5>lockd: cannot monitor %s lockd: nsm_unmonitor(%s) <5>lockd: cannot unmonitor %s localhostnsm: xdr_encode_mon(%08x, %d, %d, %d) %d.%d.%d.%dnsm: xdr_decode_stat_res status %d state %d sm_notifysm_simu_crashsm_unmon_allsm_unmonsm_monsm_statsm_nullstatdunknownnone<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%x/%ld) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! <5>lockd: bad cookie size %d (only cookies under 8 bytes are supported.) <5>lockd: bad fhandle size %x (should be %d) nlm_undefnlm_granted_resnlm_unlock_resnlm_canc_resnlm_lock_resnlm_test_resnlm_granted_msgnlm_unlock_msgnlm_canc_msgnlm_lock_msgnlm_test_msgnlm_grantednlm_unlocknlm_cancnlm_locknlm_testnlm_nulllockdunknownnone<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%x/%ld) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! <5>lockd: bad cookie size %d (only cookies under 8 bytes are supported.) <5>lockd: bad fhandle size %x (should be %d) xdr: before encode_testres (p %p resp %p) xdr: encode_testres (status %d pid %d type %d start %ld end %ld) xdr: after encode_testres (p %p resp %p) nlm4_undefnlm4_granted_resnlm4_unlock_resnlm4_canc_resnlm4_lock_resnlm4_test_resnlm4_granted_msgnlm4_unlock_msgnlm4_canc_msgnlm4_lock_msgnlm4_test_msgnlm4_grantednlm4_unlocknlm4_cancnlm4_locknlm4_testnlm4_nullunknownnone<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%x/%ld) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! <5>lockd: unauthenticated request from (%08x:%d) lockd: NULL called lockd: TEST4 called lockd: TEST4 status %d lockd: LOCK called lockd: LOCK status %d lockd: CANCEL called lockd: CANCEL status %d lockd: UNLOCK called lockd: UNLOCK status %d lockd: GRANTED called lockd: GRANTED status %d lockd: TEST_MSG called lockd: LOCK_MSG called lockd: CANCEL_MSG called lockd: UNLOCK_MSG called lockd: GRANTED_MSG called lockd: SHARE called lockd: SHARE status %d lockd: UNSHARE called lockd: UNSHARE status %d lockd: NM_LOCK called lockd: SM_NOTIFY called <4>lockd: rejected NSM callback from %08x:%d lockd: %4d callback failed (errno = %d) Unable to load NLS charset %s: name too long nls_%sUnable to load NLS charset %s defaultcp437ufs_free_fragmentsinternal errorfreeing blocks are outside deviceinternal error, bad magic number on cg %ubit already cleared for fragment %uufs_free_blocksinternal error, fragment %u, count %u freeing free fragmentufs_new_fragmentsinternal warning fragment %u, count %uinternal error, fragment %u, tmp %u <3>ufs_new_fragments: bread fail ufs_add_fragmentsinternal error or corrupted bitmap on cg %uufs_alloc_fragmentsufs_bitmap_searchbitmap corrupted on cg %u, start %u, length %u, count %u, freeoff %u block not in map on cg %u ufs_read_cylindercan't read cylinder group block %uufs_put_cylinderinternal errorufs_load_cylinderinternal error, high number of cginternal error, wrong number of cg in cacheufs_readdir: dir inode %lu has a hole at offset %lu ufs_readdirreclen is smaller than minimalreclen % 4 != 0reclen is too small for namlendirectory entry across blocksinode out of boundsbad entry in directory #%lu, size %lu: %s - offset=%lu, inode=%lu, reclen=%d, namlen=%dufs_file_writemode = %07oufs_free_inodeinode has count=%d inode has nlink=%d reserved inode or nonexistent inode %u ufs_free_fragmentsinternal error, bad cg magic numberbit already cleared for inode %uufs_new_inodecylinder group %u corrupted - error in inode bitmap internal errorufs_bmapblock > bigufs_getblkufs_read_inodebad inode number (%lu) unable to read inode %lu inode %lu has zero nlink ufs_find_entrydirectory #%lu contains a hole at offset %luufs_add_entryinternal error fragoff %uufs_delete_entry...empty_dirbad directory (dir #%lu) - no data blockbad directory (dir #%lu) - no `.' or `..'ufs_rmdirempty directory has nlink!=2 (%d)ufs_unlinkDeleting nonexistent file (%lu), %dUFS-fs panic (device %s): %s: %s <2>UFS-fs error (device %s): %s: %s <2>UFS-fs panic (device %s): %s: %s <4>UFS-fs warning (device %s): %s: %s ,ufstypeoldsun44bsdnextstepnextstep-cdopenstepsunx86UFS-fs: Invalid type option: %s onerrorpaniclockumountrepairUFS-fs: Unable to do repair on error, will lock lock instead UFS-fs: Invalid action onerror: %s UFS-fs: Invalid option: %s wrong mount options You didn't specify the type of your ufs filesystem mount -t ufs -o ufstype=sun|sunx86|44bsd|old|nextstep|netxstep-cd|openstep ... >>>WARNING<<< Wrong ufstype may corrupt your filesystem, default is ufstype=old <6>ufstype=old is supported read-only <6>ufstype=nextstep is supported read-only <6>ufstype=nextstep-cd is supported read-only <6>ufstype=openstep is supported read-only unknown ufstype ufs_read_super: bad magic number ufs_read_super: fs_bsize %u != {4096, 8192} ufs_read_super: fs_fsize %u != {512, 1024, 2048} ufs_read_super: fs is active ufs_read_super: fs is bad ufs_read_super: can't grok fs_clean 0x%x ufs_read_super: fs needs fsck ufstype can't be changed during remount this ufstype is read-only supported failed during remounting ufsufs_trunc_directinternal errorufs_truncate_direct...%ddevpts_put_super: badness: entry %d count %d ,uidgidmodedevpts: called with bogus options devpts: get root dentry failed devpts<3>socki_lookup: socket file changed! <3>sock_release: fasync list not empty! <7>sock_close: NULL inode net-pf-%d<4>socket: no more sockets <2>protocol %d >= NPROTO(%d) <6>Linux NET4.0 for Linux 2.2 <6>Based upon Swansea University Computer Society NET3.039 sockets: used %d INETSNAP802.2UNIXPACKETNETLINK<7>sk_free: optmem leakage (%d bytes) detected. sockskput:over: %p:%d put:%d dev:%sskput:under: %p:%d put:%d dev:%sNetworking buffers in use : %u Total network buffer allocations : %u Total failed network buffer allocs : %u IP fragment buffer size : %u <3>alloc_skb called nonatomically from interrupt %p <4>Warning: kfree_skb passed an skb still on a list (from %p). skbuff_head_cachecannot create skbuff cacheoptmem_maxmessage_burstmessage_costnetdev_max_backlogrmem_defaultwmem_defaultrmem_maxwmem_max100baseFX100baseTX100baseTAUI10baseTBNCunknown<4>dev_remove_pack: %p not found. <7>%s: default_rebuild_header called -- BUG! NULL!!!dev_close: bug %s still running <7>protocol %04x is buggy, dev %s <7>BUG: packet without dst looped back 1 <7>Virtual device %s asks to queue packet! <2>%s: wrong mac.raw ptr, proto=%04x %6s:%8lu %7lu %4lu %4lu %4lu %5lu %10lu %9lu %8lu %7lu %4lu %4lu %4lu %5lu %7lu %10lu %6s: No statistics available. Inter-| Receive | Transmit face |bytes packets errs drop fifo frame compressed multicast|bytes packets errs drop fifo colls carrier compressed %08x %08x %08x %08x %08x <6>device %s %s promiscuous mode enteredleft<6>early initialization of device %s is deferred devnet/dev_statdev_mc_discard: multicast leakage! dmi_users=%d %-4d %-15s %-5d %-5d %02x net/dev_mcastneigh_ifdown: impossible event 1763 neigh_destroy: neighbour is use tbl=%p, ref=%d: called from %p neigh: timer & !nud_in_timer neigh_resolve_output: dst=%p neigh=%p neigh_release_parms: not found <2>neighbour leakage netneighdefaultgc_thresh3gc_thresh2gc_thresh1gc_intervallocktimeproxy_delayanycast_delayproxy_qlenunres_qlengc_stale_timedelay_first_probe_timebase_reachable_timeretrans_timeapp_solicitucast_solicitmcast_solicit<4>NET: %d messages suppressed. <7>%s: unable to resolve type %X addresses. EtherII<7>%s deferred output. It is buggy. <6>%s: activation failed Assertion (dev->qdisc_list == NULL) failed at sch_generic.c(%d):dev_shutdown 802.2SNAP - unable to register with 802.2 SNAP802.3<3>IP_MASQ:ip_masq_app_init_fwmark(): fwmark must be <= %d, sorry (shoot Juanjo) ICMPTCPUDPIP_%dBUG!LISTENLAST_ACKCLOSE_WAITCLOSETIME_WAITFIN_WAITSYN_RECVSYN_SENTESTABLISHEDNONEERR!<3>IP_MASQ:ip_masq_hash(): request for already hashed, called from %p <3>IP_MASQ:ip_masq_unhash(): request for unhash flagged, called from %p <3>IP_MASQ:ip_masq_new(proto=%s): no free ports. <3>IP_MASQ:ip_masq_new(proto=%s): no memory available. <3>IP_MASQ:Already used connection: %s, %d.%d.%d.%d:%d => %d.%d.%d.%d:%d, called from %p <3>IP_MASQ:ip_masq_new(proto=%s): could not get free masq entry (free=%d). <6>IP_MASQ:ip_fw_masquerade(): change masq.addr from %d.%d.%d.%d to %d.%d.%d.%d <6>IP_MASQ:ip_fw_masq_icmp(): change masq.addr %d.%d.%d.%d to %d.%d.%d.%d<3>IP_MASQ:reverse ICMP: failed checksum from %d.%d.%d.%d! <3>IP_MASQ:request control ADD for already controlled: %d.%d.%d.%d:%d to %d.%d.%d.%d:%d <3>IP_MASQ:request control DEL for uncontrolled: %d.%d.%d.%d:%d to %d.%d.%d.%d:%d <3>IP_MASQ:BUG control DEL with n=0 : %d.%d.%d.%d:%d to %d.%d.%d.%d:%d Prc FromIP FPrt ToIP TPrt Masq Init-seq Delta PDelta Expires (free=%d,%d,%d)%-127s %s %08X:%04X %08X:%04X %04X %08X %6d %6d %7luip_masq_usernet/ip_masq<3>IP_MASQ:Could not create "/proc/net/ip_masq" entry ip_masquerade -$ htcp-؁$  dudp. $  dicmp.h$  d<3>IP_MASQ:ip_masq_app_init_fwmark(): fwmark must be <= %d, sorry (shoot Juanjo) ICMPTCPUDPIP_%d<3>IP_MASQ:unregister_ip_masq_app(): NULL arg <3>IP_MASQ:unregister_ip_masq_app(): has %d attachments. failed <3>IP_MASQ:unregister_ip_masq_app(flags=0x%x, proto=%s,port=%u,fwmark=%d): not hashed! <3>IP_MASQ:ip_masq_app: tried to set n_attach < 0 for (proto=%s,port==%d) ip_masq_app object. <3>IP_MASQ:ip_masq_bind_app() called for already bound object. %-39s prot port n_attach name%-3s %-7u %-7d %-17s app<3>IP_MASQ:skb_replace(): no room left (from %p) %d.%d.%d.%d%-127s Iface Destination Gateway Flags RefCnt Use Metric Source MTU Window IRTT TOS HHRef HHUptod SpecDst%s %08lX %08lX %8X %d %u %d %08lX %d %u %u %02X %d %1d %08X*dst cache overflow neighbour table overflow <7>ip_rt_bug: %08x -> %08x, %s ?<2>Bug in ip_route_input_slow(). Please, report mtu_expiresgc_elasticityerror_bursterror_costredirect_silenceredirect_numberredirect_loadgc_intervalgc_timeoutgc_min_intervalmax_sizegc_threshmax_delaymin_delayflushrt_cache3p$ P%4d: %08lX:%04X %08lX:%04X %02X %08X:%08X %02X:%08lX %08X %5d %8d %u%4d: %08lX:%04X %08lX:%04X %02X %08X:%08X %02X:%08lX %08X %5d %8d %lu%-127s sl local_address rem_address st tx_queue rx_queue tr tm->when retrnsmt uid timeout inodeTCP: inuse %d highest %d UDP: inuse %d highest %d RAW: inuse %d highest %d Ip: Forwarding DefaultTTL InReceives InHdrErrors InAddrErrors ForwDatagrams InUnknownProtos InDiscards InDelivers OutRequests OutDiscards OutNoRoutes ReasmTimeout ReasmReqds ReasmOKs ReasmFails FragOKs FragFails FragCreates Ip: %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu Icmp: InMsgs InErrors InDestUnreachs InTimeExcds InParmProbs InSrcQuenchs InRedirects InEchos InEchoReps InTimestamps InTimestampReps InAddrMasks InAddrMaskReps OutMsgs OutErrors OutDestUnreachs OutTimeExcds OutParmProbs OutSrcQuenchs OutRedirects OutEchos OutEchoReps OutTimestamps OutTimestampReps OutAddrMasks OutAddrMaskReps Icmp: %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu Tcp: RtoAlgorithm RtoMin RtoMax MaxConn ActiveOpens PassiveOpens AttemptFails EstabResets CurrEstab InSegs OutSegs RetransSegs InErrs OutRsts Tcp: %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu Udp: InDatagrams NoPorts InErrors OutDatagrams Udp: %lu %lu %lu %lu TcpExt: SyncookiesSent SyncookiesRecv SyncookiesFailed EmbryonicRsts PruneCalled RcvPruned OfoPruned OutOfWindowIcmps LockDroppedIcmps SockMallocOOM TcpExt: %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu IpExt: ArpFilter IpExt: %lu <7>non CLOSE socket in time_done net_timer: timer expired - reason %d is unknown IGMPTCPUDPICMP<3>IP_MASQ:ip_masq_app_init_fwmark(): fwmark must be <= %d, sorry (shoot Juanjo) ICMPTCPUDPIP_%d<7>ip_input(): demasq recursion detected. Check masq modules configuration <6>source route option %d.%d.%d.%d -> %d.%d.%d.%d ip_evictor: memcount<6>Oversized IP packet from %d.%d.%d.%d. <6>Oversized packet received from %d.%d.%d.%d <3>IP_MASQ:ip_masq_app_init_fwmark(): fwmark must be <= %d, sorry (shoot Juanjo) ICMPTCPUDPIP_%d<2>ip_forward(): Argh! Destination lost! igmp<7>tcp_readable: %p - <7>empty <7>got %lu bytes. <6>recvmsg bug: copied %X seq %X tcp_close: socket already locked! tcp_open_requesttcp_init: Cannot alloc open_request cache.tcp_bind_buckettcp_init: Cannot alloc tcp_bind_bucket cache.tcp_tw_buckettcp_init: Cannot alloc tcp_tw_bucket cache.Failed to allocate TCP established hash table Failed to allocate TCP bind hash table TCP: Hash tables configured (ehash %d bhash %d) tcp_parse_options: Illegal window scaling value %d >14 received.<7>Ack ignored %u %u tcp_fin: Impossible, sk->state=%d <7>ofo packet was already received <7>ofo requeuing : rcv_next %X seq %X - %X <7>retransmit received: seq %X <7>partial packet: rcv_next %X seq %X - %X <7>out of order segment: rcv_next %X seq %X - %X <7>*** tcp.c:tcp_data bug acked < copied <7>prune_queue: c=%x <7>seq:%d end:%d wup:%d wnd:%d <7>syn in established state <7>bad ack tcp_select_window: tp->window_clamp == 0. tcp_select_window: sk->mss fell to 0. <7>initial req->mss below 8 <7>tcpbug: unknown timer value <7>bug: tcp_reset_xmit_timer TIME_WRITE <7>bug: unknown timer value tcp_v4_hash: bug, socket state is %d <7>%s forgot to set AF_INET in tcp_v4_connect <6>possible SYN flooding on port %d. Sending cookies. <7>Reset on %p: Connect on dead socket. <4>tcp_v4_rebuild_header(): not valid sock addrs: saddr=%08X rcv_saddr=%08X <6>tcp_v4_rebuild_header(): shifting sk->saddr from %d.%d.%d.%d to %d.%d.%d.%d Failed to create the TCP control socket. <6>%s forgot to set AF_INET in raw sendmsg. Fix it! <4>%s forgot to set AF_INET in udp sendmsg. Fix it! <7>trying to ucast probe in NUD_INVALID <7>ARP: arp called for own IP address <7>arp_find is called with dst==NULL 0123456789ABCDEFIP address HW type Flags HW address Mask Device %-17s0x%-10x0x%-10x%s %-17s %s *00:00:00:00:00:00arpipv4<3>IP_MASQ:ip_masq_app_init_fwmark(): fwmark must be <= %d, sorry (shoot Juanjo) ICMPTCPUDPIP_%d<7>icmp_send: destinationless packet <6>ICMP: %d.%d.%d.%d: fragmentation needed and DF set. <6>ICMP: %d.%d.%d.%d: Source Route Failed. <4>%d.%d.%d.%d sent an invalid ICMP error to a broadcast. <6>Wrong address mask %08X from %08X/%s Failed to create the ICMP control socket. ipv4<7>inetdev_event: bug netconfallarp_filterhiddenlog_martiansbootp_relayproxy_arpaccept_source_routesend_redirectsrp_filtershared_mediasecure_redirectsaccept_redirectsmc_forwardingforwardingdefault<3>IP_MASQ:ip_masq_app_init_fwmark(): fwmark must be <= %d, sorry (shoot Juanjo) ICMPTCPUDPIP_%d<6>%s uses obsolete (PF_INET,SOCK_PACKET) rarprawnetstatsnmpsockstattcpudp<6>NET4: Linux TCP/IP 1.0 for NET4.0 <2>inet_proto_init: panic <6>IP Protocols: %s%s, Idx Device : Count Querier Group Users Timer Reporter NONEV1V2%d %-10s: %5d %7s %08lX %5d %d:%08lX %d igmp_max_membershipsrouteicmp_echoreply_rateicmp_paramprob_rateicmp_timeexceed_rateicmp_destunreach_rateicmp_ignore_bogus_error_responsesicmp_echo_ignore_broadcastsicmp_echo_ignore_allip_local_port_rangetcp_max_syn_backlogtcp_rfc1337tcp_stdurgtcp_fin_timeouttcp_retries2tcp_retries1tcp_keepalive_probestcp_keepalive_timetcp_max_ka_probesipfrag_timeip_masq_udp_dlooseip_masq_debugip_always_defragip_dynaddripfrag_low_threshipfrag_high_threshtcp_syn_retriesip_no_pmtu_discip_autoconfigip_default_ttlip_forwardtcp_retrans_collapsetcp_sacktcp_window_scalingtcp_timestamps%-127s Iface Destination Gateway Flags RefCnt Use Metric Mask MTU Window IRTT<7>fib_add_ifaddr: bug: prim == NULL <7>fib_del_ifaddr: bug: prim == NULL routeM$ Ӝ<7>impossible 102 %s %08X %08X %04X %d %u %d %08X %d %u %u** %08X %08X %04X %d %u %d %08X %d %u %u<3>IP_MASQ:ip_masq_app_init_fwmark(): fwmark must be <= %d, sorry (shoot Juanjo) ICMPTCPUDPIP_%dDENYACCEPTREJECTREDIRECTMASQ-RETURNUNKNOWN<6>Packet log: %s %s %d %s PROTO=%d %d.%d.%d.%d:%hu %d.%d.%d.%d:%hu L=%hu S=0x%2.2hX I=%hu F=0x%4.4hX T=%hu O=0x%8.8X %s(#%d) SYN <3>Chain backtrace: %s<-%s Suspect TCP fragment. Suspect short first fragment. <3>IP firewall: Loop detected at `%s'. Can't kmalloc for firewall chains. %9s %08X/%08X->%08X/%08X %.16s %X %X %u %-9u %-9u %-9u %-9u %u-%u %u-%u A%02X X%02X %08X %u %u %9s %s %s %i %u %u %u %u ip_fwchainsip_fwnamesinputforwardoutputUnable to register IP firewall. tunl0dvmrp%dpimreg<4>mroute: pending queue full, dropping entries. Interface BytesIn PktsIn BytesOut PktsOut Flags Local Remote none%2d %-10s %8ld %7ld %8ld %7ld %05X %08X %08X Group Origin Iif Pkts Bytes Wrong Oifs %08lX %08lX %-3d %8ld %8ld %8ld %2d:%-3d ip_mr_vifip_mr_cache<6>Linux IP multicast router 0.06 plus PIM-SM dummy<4>DHCP/BOOTP: Ignoring device %s, MTU %d too small<3>IP-Config: Can't open %s <3>IP-Config: No such device: %s <3>IP-Config: No network devices available <3>IP-Config: Can't set interface address: Error %d <3>IP-Config: Can't set netmask: Error %d <3>IP-Config: Can't set broadcast address: Error %d <3>IP-Config: Gateway not on directly connected network <3>IP-Config: Can't add default route: Error %d <3>IP-Config: Can't guess netmask for %s IP-Config: Guessing netmask: %s #PROTO: %s DHCPBOOTPRARP#MANUAL domain %s nameserver %s pnpT؁$ ?<3>IP-Config: Not enough information IP-Config: Complete: if=%s, addr=%s, mask=%s, gw=%s, host=%s, domain=%s, nis-domain=%s, bootserver=%s, rootserver=%s, rootpath=%s onanyoffnone%08xNum RefCount Protocol Flags Type St Inode Path %p: %08X %08X %08lX %04X %02X %5ld<6>NET4: Unix domain sockets 1.0 for Linux NET4.0. <2>unix_proto_init: panic net/unixmax_dgram_qlendelete_delaydestroy_delay<7>netlink_release: impossible event. Please, report. sk Eth Pid Groups Rmem Wmem Dump Locks %p %-3d %-6d %08x %-8d %-8d %p %d<2>netlink_proto_init: panic net/netlinkunknownnoneunknownnoneRPC: creating %s client for %s (xprt %p) bindwait<6>RPC: out of memory in rpc_create_client <6>RPC: Couldn't create auth handle (flavor %d) RPC: shutting down %s client for %s RPC: rpc_shutdown_client: client %s, tasks=%d RPC: destroying %s client for %s RPC: rpc_release_client(%p, %d) rpc_call_sync: Illegal flag combination for synchronous task <4>%s (vers %d): bad procedure number %d RPC: %4d call_reserve RPC: %4d call_reserveresult (status %d) call_reserveresult: status=%d, request=%p?? RPC: task timed out <6>RPC: task has no request, exit EIO RPC: %4d call_allocate (status %d) <6>RPC: buffer allocation failed for task %p RPC: %4d call_encode (status %d) <6>RPC: call_header failed, exit EIO <4>%s: can't encode arguments: %d RPC: %4d call_reconnect status %d RPC: %4d call_transmit (status %d) RPC: %4d call_status (status %d) %s: RPC call returned error %d RPC: %4d call_timeout (minor timeo) <5>%s: task %d can't get a request slot RPC: %4d call_timeout (major timeo) <5>%s: server %s not responding, timed out RPC: %4d call_decode (status %d) <4>%s: too small RPC reply size (%d bytes) RPC: %4d retry squashed uid RPC: %4d call_decode result %d RPC: %4d call_refresh RPC: %4d call_refreshresult (status %d) <4>call_verify: not an RPC reply: %x <4>call_verify: RPC call rejected: %x RPC: %4d call_verify: retry stale creds RPC: %4d call_verify: retry garbled creds <5>call_verify: server requires stronger authentication. <4>call_verify: unknown auth error: %x RPC: %4d call_verify: call rejected %d <4>call_verify: auth check failed <4>call_verify: server accept status: %x RPC: %4d call_verify: server saw garbage <4>RPC: garbage, retrying %4d <4>RPC: garbage, exit EIO unknownnonepacket data:RPC: xprt_sendmsg(%d) = %d <5>RPC: sendmsg returned error %d RPC: xprt_recvmsg(iov %p, len %d) = %d RPC: cong %08lx, cwnd was %08lx, now %08lx, time %ld ms RPC: cong %ld, cwnd was %ld, now %ld, time %ld ms <4>xprt_adjust_timeout: to_current = 0! RPC: disconnected transport %p RPC: %4d xprt_reconnect %p connected %d RPC: %4d connecting new socket RPC: TCP connect error %d! RPC: %4d connect status %d connected %d xprt_lookup_rqst: loop in Q! RPC: unknown XID %08x in reply. RPC: %4d has input (%d bytes) RPC: udp_data_ready... RPC: udp_data_ready request not found! RPC: udp_data_ready client %p RPC: impossible RPC reply size %d! RPC: %4d received reply, (%d bytes) RPC: reading header (%d bytes) RPC: New record reclen %d morefrags %d RPC: reading xid (%d bytes) RPC: %4d TCP receiving %d bytes RPC: %4d received reply complete RPC: TCP skipping %d bytes RPC: tcp_input_record RPC: tcp_input_record done (off %d reclen %d copied %d) RPC: xprt queue %p rpciod_tcp_dispatcher: Queue Running rpciod_tcp_dispatcher: Processing %p RPC: tcp_data_ready... Not a socket with xprt %p RPC: tcp_data_ready client %p RPC: state %x conn %d dead %d zapped %d RPC: tcp_state_change client %p... RPC: %4d xprt_timer (%s request) pendingbackloggedRPC: %4d TCP write queue full (task %d) RPC: %4d xprt_transmit(%x) RPC: %4d xmit incomplete (%d left of %d) RPC: %4d xmit complete RPC: %4d xprt_receive RPC: %4d xprt_reserve cong = %ld cwnd = %ld RPC: xprt_reserve waiting on backlog RPC: %4d xprt_reserve returns %d RPC: %4d reserved req %p xid %08x RPC: %4d release request %p RPC: %4d xprt_ping_reserve cong = %ld cwnd = %ld RPC: %4d xprt_ping_reserve returns %d doh, NFS bugRPC: setting up %s transport... UDPTCPxprt_pendingxprt_sendingxprt_backlogxprt_reconnxprt_pingwaitRPC: created transport %p RPC: Can't bind to reserved port (%d). RPC: xprt_create_socket(%s %d) udptcpRPC: can't create socket (%d). RPC: xprt_create_proto called RPC: destroying transport %p unknownnoneschedqchildqdelayqRPC: %4d disabling timer RPC: %4d running timer RPC: %4d setting alarm for %lu ms RPC: %4d deleting timer <4>RPC: task already queued! task already on %s, to be added to %s RPC: %4d added to queue %p "%s" RPC: %4d removed from queue %p "%s" <3>RPC: task w/ running timer in rpc_make_runnable!! <4>RPC: failed to add task to queue: error: %d! <3>rpciod: wot no daemon? RPC: %4d sleep_on(queue "%s" time %ld) <3>RPC: Inactive synchronous task put to sleep! RPC: %4d __rpc_wake_up (now %ld inh %d) <3>RPC: attempt to wake up non-existing task! <3>RPC: Inactive task (%p) being woken up! RPC: __rpc_wake_up done RPC: %4d timeout (default timer) RPC: wake_up_next(%p "%s") RPC: %4d rpc_execute flgs %x <4>RPC: rpc_execute called for sleeping task!! RPC: %4d sync task going to sleep <3>RPC: rpciod waiting on sync task %4d! RPC: %4d sync task resuming RPC: %4d got signal RPC: %4d exit() = %d <3>RPC: dead task tries to walk away. <6>RPC: execution inhibited! <3>RPC: active task was run twice! RPC: rpc_schedule enter <3>RPC: Locked task was scheduled !!!! RPC: rpc_schedule leave RPC: allocated buffer %p RPC: used last-ditch swap buffer RPC: %d new task procpid %d%s (alloc)rpc_new_task: failed, users=%d, oneshot=%d RPC: %4d release task <3>RPC: attempt to release a non-existing task! RPC: %4d freeing task RPC: killing all tasks for client %p rpciodRPC: rpciod starting (pid %d) RPC: rpciod back to sleep RPC: switch to rpciod RPC: rpciod shutdown commences <3>rpciod: active tasks at shutdown?! RPC: rpciod exiting rpciod_killall: waiting for tasks to exit rpciod_up: pid %d, users %d <4>rpciod_up: no pid, %d users?? <4>rpciod_up: create thread failed, error=%d rpciod_down pid %d sema %d <4>rpciod_down: pid=%d, no users?? rpciod_down: Nothing to do! rpciod_down: waiting for pid %d to exit rpciod_down: caught signal -pid- proc flgs status -client- -prog- --rqstp- -timeout -rpcwait -action- --exit-- %05d %04d %04x %06d %8p %6d %8p %08ld %8s %8p %8p unknownnoneRPC: gc'ing RPC credentials for auth %p RPC: looking up %s cred RPC: %4d looking up %s cred RPC: matching %s cred %d RPC: %4d holding %s cred %p RPC: %4d releasing %s cred %p RPC: %4d marshaling %s cred %p RPC: %4d validating %s cred %p RPC: %4d refreshing %s cred %p RPC: %4d invalidating %s cred %p unknownnoneRPC: creating NULL authenticator for client %p RPC: destroying NULL authenticator %p RPC: bad verf flavor: %ld RPC: bad verf size: %ld NULLunknownnoneRPC: creating UNIX authenticator for client %p RPC: destroying UNIX authenticator %p RPC: allocating UNIX cred for uid %d gid %d RPC: allocating fake UNIX cred for uid %d gid %d RPC: bad verf flavor: %ld RPC: giant verf size: %ld UNIXunknownnoneRPC: svc_destroy(%s, %d) svc_destroy: no threads for serv=%p! RPC: svc_register(%s, %s, %d) udptcpsvc: failed to encode reply svc: calling dispatcher svc: svc_process dropit svc: short len %d, dropping request svc: bad direction %d, dropping request svc: authentication failed (%d) svc: unknown program %d (me %d) svc: unknown version (%d) svc: unknown procedure (%d) svc: failed to decode args svc: service %p, releasing skb %p <3>svc_sock_enqueue: threads and sockets both waiting?? svc: socket %p busy, not enqueued svc: socket %p served by daemon %p <3>svc_sock_enqueue: server %p, rq_sock=%p! svc: socket %p put into queue svc: socket %p dequeued, inuse=%d <5>svc: sk_data negative! svc: socket %p re-enqueued after receive svc: socket %p re-enqueued after accept svc: releasing dead socket svc: daemon %p woken up. svc: socket %p sendto([%p %d... ], %d, %d) = %d svc: socket %p recvfrom(%p, %d) = %d svc: socket %p(inet %p), count=%d, busy=%d svc: recvfrom returned error %d svc: socket %p TCP (listen) state change %d svc: socket %p: no user data svc: socket %p TCP (connected) state change %d (svsk %p) svc: socket %p TCP data ready (svsk %p) svc: tcp_accept %p sock %p <4>%s: no more sockets! svc: tcp_accept %p allocated <4>%s: socket dup failed (err %d)! <4>%s: accept failed (err %d)! <4>%s: peername failed (err %d)! <4>%s: connect from unprivileged port: %u.%u.%u.%u:%d %s: connect from %s:%04x svc: tcp_recv %p data %d conn %d close %d <5>RPC: bad TCP reclen %08lxsvc: TCP record, %d bytes svc: incomplete TCP record (%d of %d) svc_recv: more data at hte socket len %d > svsk->sk_reclen %dsvc: TCP complete record (%d bytes) RPC: TCP recvfrom got EAGAIN <5>%s: recvfrom returned errno %d setting up TCP socket for listening setting up TCP socket for reading svc: server %p waiting for data (to = %ld) <3>svc_recv: service %p, socket not NULL! <3>svc_recv: service %p, wait queue active! svc: server %p, no data yet svc: server %p, socket %p, inuse=%d svc: got len=%d svc: socket %p dropped request <4>NULL socket pointer in %s:%d svcsock.csvc: svc_setup_socket %p <4>svsk->sk_sk == NULL after svc_prot_init! svc: svc_setup_socket created %p (inet %p) svc: svc_create_socket(%s, %d, %08x:%d) <4>svc: only UDP and TCP sockets supported svc: svc_create_socket error = %d svc: svc_delete_socket(%p) <5>svc: server socket destroy delayed (sk_inuse: %d) svc: creating socket proto = %d svc: svc_authenticate (%d) svc: bad null cred svc: bad null verf unknownnoneRPC: %4d rpc_getport(%s, %d, %d, %d) RPC: rpc_getport_external(%s, %d, %d, %d) RPC: %4d pmap_getport_done(status %d, port %d) RPC: registering (%d, %d, %d, %d) with portmapper. localhostRPC: couldn't create pmap client <4>RPC: failed to contact portmap (errno %d). RPC: registration status %d/%d RPC: xdr_encode_mapping(%d, %d, %d, %d) pmap_getpmap_unsetpmap_setpmap_nullportmapunknownnoneRPC: %4d, ping_call_reserve RPC: %4d, ping_call_allocate (status %d) RPC: %4d, ping_call_encode (status %d) RPC: %4d, ping_call_transmit RPC: %4d, ping_call_receive (status %d) <5>%s: server %s OK <5>%s: server %s is not responding <5>%s: server %s still not responding RPC: %4d, ping_call_exit (status %d) RPC: %4d, rpc_ping RPC: %4d, rpc_ping, waiting on completion RPC: %4d, rpc_ping, failed to create child process RPC: %4d, rpc_ping, running child process %4d <7>RPC: Urk! Large shift of short iovec. unknownnone%dnlm_debugnfsd_debugnfs_debugrpc_debugsunrpcunknownnonenet %d %d %d %d rpc %d %d %d proc%d %d %drpc %d %d %d %d %d RPC: registering /proc/net/rpc/%s RPC: registering /proc/net/rpc net/rpcRPC: unregistering /proc/net/rpc ipv4ethernet802unixcoremapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... get_request(%d): impossible! <3>drive_stat_acct: cmd not R/W? elevator_starve_rest_of_queue<6>attempt to access beyond end of device <6>%s: rw=%d, want=%d, limit=%d <6>dev %s blksize=%d blocknr=%ld sector=%ld size=%ld count=%d <3>make_request: bad block dev cmd, must be R/W/RA/WA <3>ll_rw_block: Trying to read nonexistent block-device %s (%ld) <5>ll_rw_block: device %s: only %d-char blocks implemented (%lu) <3>Bad md_map in ll_rw_block <5>Can't write to read-only device %s end_request: I/O error, dev %s (%s), sector %lu end_request: buffer-list destroyed looploop: request list destroyedloop: block not locked<3>unknown loop device command (%d)?!?<3>loop: device %s: getblk(-, %d, %d) returned NULL<3>loop: transfer error block %d <4>loop: cannot create block - no backing file <4>loop: cannot create block - no file ops <4>loop: cannot create block - file not writeable <4>loop: cannot create block - FS write failed: code %d <3>loop_set_fd: NULL inode?!? <3>loop: device has no block access/not implemented <4>lo_ioctl: pseudo-major != %d <4>lo_open: pseudo-major != %d <4>lo_release: pseudo-major != %d <3>lo_release: refcount(%d) <= 0 <4>Unable to get major number %d for loop device <6>loop: registered device at major %d md[dev %s]<3>md: %s: invalid raid superblock magic (%x) on block %u <1>md: out of memory. <3>md: disabled device %s <3>md: superblock inconsistency -- run ckraid <3>md: superblock update time inconsistenty -- using the most recent one <1>md: %s: unsupported raid array version %d.%d.%d <3>md: %s: raid array is not clean -- run ckraid <3>md: %s: unsupported raid level %d md: updating raid superblock on device %s, sb_offset == %u <3>md: getblk failed for device %s md-personality-%dDev %s smaller than %dk, cannot shrink STOP_MD md%x failed : i_count=%d, busy=%d md_add(): zero device size, huh, bailing out. FIXME REGISTER_DEV %s to md%x done Bad md device %d Oops ! md%d not running, giving up ! Got md request, not good...Killing md_thread %d %p %s Aiee. md_thread has 0 tsk downing on %p md_threadmdstatmd_error gets unknown device md_error gets an error for an unknown device Personalities : [%d %s] read_ahead not set %d sectors md%d : %sactivein %s %d blocks maxfault=%ld%s personality registered %s personality unregistered ... resync log .... mddev->nb_dev: %d .... raid array: %s .... max_blocks: %d blocksize: %d md: syncing RAID array %s <1>read error, stopping reconstruction. %03d%% done. .md: %s: sync done. md driver %d.%d.%d MAX_MD_DEV=%d, MAX_REAL=%d Unable to get major %d for md %s/c%dd%d%s/c%dd%dp%dhdsd%c%c%d%s%c%d%s%c %sStrange blocksize for partition table [s%d] >??? unable to read partition table %s: RESETTINGING SECTOR SCALE from %d to 1 <! Dev %s: unable to read partition table Dev %s Sun disklabel: Csum bad, label corrupted Dev %s SGI disklabel: csum bad, label corrupted Dev %s: unable to read RDB block %d Dev %s: RDB in block %d has bad checksum Warning: Trashed word at 0xd0 in block %d ignored in checksum calculation RDSKDev %s: unable to read partition block %d %s: error reading partition table <6>Partition check: <6> %s: unknown partition table major minor #blocks name %4d %4d %10d %s mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... DMA timeoutfloppy: Asked to read unknown port %d floppy: Port bolixed.sun_82072_fd_inb: How did I get here?floppy: Asked to write to unknown port %d Can't set AUXIO register on this machine.Unknown dma mode %d floppy: Giving up...floppyobioSUNW,fdtwofdstatusdisabledreg2.88M2.88M AMI BIOS1.44M720k1.2M360K PCunknownH1600D800H1840E3840E3520E3200H1920H1760h1600D1120D1040h880H1743h1494H830h420H1722h1476H820h410H1680h1440E3120E2880H1440h720h360D720D360h1200d360%s dtime=%lu floppy%d: timeout handler died: %s floppy%d: reschedule timeout floppy%d: WARNING disk change called early floppy%d: probing disk change on unselected drive floppy%d: drive=%d fdc=%d dor=%x floppy%d: checking disk change line for drive %d floppy%d: jiffies=%lu floppy%d: disk change line=%x floppy%d: flags=%lx floppy%d: Disk type is undefined after disk change floppy%d: calling disk change from set_dor bad fdc value <3>Trying to lock fdc while usage count=0 lock fdcfloppy%d: FDC access conflict! floppy%d: device interrupt still active at FDC release: %p! floppy%d: calling disk change from watchdog floppy%d: disk removed during i/o zero dma transfer size:%x,non aligned address: %p floppy%d: Getstatus times out (%x) on fdc %d floppy%d: Unable to send byte %x to FDC. Fdc=%x Status=%x floppy%d: get result error. Fdc=%d Last status=%x Read bytes=%d floppy%d: Invalid data rate for perpendicular mode! floppy%d: perpendicular mode not supported by this FDC. : track %d, head %d, sector %d, size %dfloppy%d: -- FDC reply errorfloppy%d: Drive is write protected floppy%d: Over/Underrun - retrying floppy%d: Recalibrate failed!data CRC errorCRC errorsector not foundprobe failed...wrong cylinderbad cylinderunknown error. ST[0..2] are: 0x%x 0x%x 0x%xfloppy%d: Invalid FDC command given! floppy%d: Abnormal termination caused by polling rw_command: seek interrupt:floppy%d: seek failed floppy%d: clearing NEWCHANGE flag because of effective seek floppy%d: checking whether disk is write protected floppy%d: wp=%x floppy%d: calling disk change from seek seek command:recal interrupt:recal interrupt need 1 recal:recal interrupt need 2 recal:floppy%d: clearing NEWCHANGE flag because of second recalibrate recal interrupt default:floppy%d: %s repl[%d]=%x DOR0=%x floppy interrupt on bizarre fdc %d handler=%p bizarre fdcunexpected interruptsenseinormal interrupt endrecalibrate floppy:reset interrupt:reset set in interrupt, calling %p floppy driver state ------------------- now=%lu last interrupt=%lu diff=%lu last called handler=%p timeout_message=%s last output bytes: %2x %2x %lu last result at %lu last redo_fd_request at %lu %2x status=%x fdc_busy=%d DEVICE_INTR=%p floppy_tq.routine=%p fd_timer.function=%p timer_table=%p expires=%lu now=%lu cont=%p CURRENT=%p command_status=%d floppy%d: floppy timeout called no cont in shutdown! floppy shutdownfloppy%d: calling disk change from floppy_ready floppy startfloppy%d: setting NEWCHANGE in floppy_start do wakeupwait_til_donequeue format requestrequest done %dfloppy%d: request list destroyed in floppy request done floppy%d: long rw: %x instead of %lx rs=%d s=%d rh=%d h=%d rt=%d t=%d heads=%d eoc=%d spt=%d st=%d ss=%d in_sector_offset=%d floppy%d: Auto-detected floppy type %s in fd%d floppy%d: in copy buffer current_count_sectors=%ld remaining=%d CURRENT->nr_sectors=%ld CURRENT->current_nr_sectors=%ld max_sector=%d ssize=%d floppy%d: buffer overrun in copy buffer %d sector_t=%d buffer_min=%d read write floppy%d: %p buffer not aligned floppy%d: bh=null in copy buffer after copy floppy%d: weirdness: remaining %d too many sectors %d > %d floppy%d: make_raw_rw_request: unknown command floppy%d: zero dma transfer attempted from make_raw_request floppy%d: indirect=%d direct=%d sector_t=%dfloppy%d: internal error offset !=0 on write floppy%d: fractionary current count b=%lx s=%lx addr=%d, length=%ld st=%d ast=%d mse=%d msi=%d ssize=%x SIZECODE=%d command=%x SECTOR=%d HEAD=%d, TRACK=%d buffer drive=%d buffer track=%d buffer_min=%d buffer_max=%d floppy%d: buffer overrun in schedule dma sector_t=%d buffer_min=%d current_count=%ld floppy%d: buffer overrun in direct transfer floppy%d: more sectors than bytes bytes=%ld sectors=%ld floppy: request list destroyedfloppy: block not lockedredo fd requestfloppy%d: disk absent or changed during operation floppy%d: no autodetectable formats queue fd requestwarning: usage count=0, CURRENT=%p exiting sect=%ld cmd=%d do fd request, old request runningdo fd requestfloppy%d: setting NEWCHANGE in poll_drive weird, reset interrupt called (null)floppy%d: calling disk change from raw_cmd ioctl user formatioctl not yet supported floppy%d: obsolete eject ioctl floppy%d: please use floppycontrol --eject unknown type %d (usb?),<6>Floppy drive(s):%s fd%d is %sfloppy%d: floppy_release with fd_ref == 0floppy%d: Weird, open called with filp=0 floppy%d: Unable to allocate DMA memory floppy%d: check_floppy_change: not a floppy <6>FDC %d is an 8272A FDC %d init: DUMPREGS: unexpected return of %d bytes. <6>FDC %d is an 82072 <6>FDC %d is an 82072A <6>FDC %d is a pre-1991 82077 FDC %d init: UNLOCK: unexpected return of %d bytes. FDC %d init: PARTID: unexpected return of %d bytes. <6>FDC %d is a post-1991 82077 <6>FDC %d is an 82078. <6>FDC %d is a 44pin 82078 <6>FDC %d is a S82078B <6>FDC %d is a National Semiconductor PC87306 <6>FDC %d init: 82078 variant with unknown PARTID=%d. floppy%d: %s flag 0x%x SettingClearingfloppy%d: Assuming %s floppy hardware standardbrokenfloppy%d: wrong number of parameters for CMOS floppy%d: bad drive for set_cmos floppy%d: setting CMOS code to %d L40SXno_unexpected_interruptsunexpected_interruptsslowcmosusefifonofifofifo_depthyesdmaomnibooknodmadebugsilent_dcl_clearmessagesbroken_dclthinkpadone_fdctwo_fdcdaringdmairqasus_pciall_drivesallowed_drive_maskfloppy%d: %s=%d floppy%d: unknown floppy option [%s] floppy%d: allowed options are: %sfloppy%d: botched floppy option floppy%d: Read linux/drivers/block/README.fd Unable to get major %d for floppy floppy initfloppy%d: no floppy controllers found floppy%d: Unable to grab IRQ%d for the floppy driver floppy%d: Unable to grab DMA%d for the floppy driver floppy%d: Floppy io-port 0x%04lx in use floppy timer still active:%s auxiliary floppy timer still active task queue still active ramdiskramdisk: request list destroyedramdisk: block not locked<6>RAMDISK: bad command: %d RAMDISK: Could not get major %dRAM disk driver initialized: %d RAM disks of %dK size <5>RAMDISK: Compressed image found at block %d <5>RAMDISK: romfs filesystem found at block %d <5>RAMDISK: Minix filesystem found at block %d <5>RAMDISK: ext2 filesystem found at block %d <5>RAMDISK: Couldn't find valid RAM disk image starting at %d. RAMDISK: image too big! (%d/%ld blocks) <3>RAMDISK: could not allocate buffer <3>RAMDISK: could not determine device size <5>RAMDISK: Loading %d blocks [%d disk%s] into ram disk... sdone disk #%d. Please insert disk #%d and press ENTER Error opening disk. Loading disk #%d... %cdone. <5>VFS: Insert root floppy disk to be loaded into RAM disk and press ENTER incomplete literal tree incomplete distance tree bad gzip magic numbersinternal error, invalid methodInput is encrypted Multi part input Input has invalid flags invalid compressed format (err=1)invalid compressed format (err=2)out of memoryinvalid compressed format (other)crc errorlength error<3>%s<3>RAMDISK: Couldn't allocate gzip buffer <3>RAMDISK: Couldn't allocate gzip window master pty_close: count = %d!! pty_ioctl called with NULL tty! pty_unix98_ioctl called with NULL tty! pty_masterptypty_slavettypCouldn't register pty driverCouldn't register pty slave driverpty: %d Unix98 ptys configured ptmptsCouldn't register Unix98 ptm driver major %dCouldn't register Unix98 pts driver major %dhead%3i %s char-major-%d-%dmiscunable to get major %d for misc devices mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... redraw_screen: tty %d not allocated ?? [%d;%dR[?6c%c%c%ccon_write: tty %d not allocated vt_console_print: tty %d not allocated ?? ttyCouldn't register console driver Console: %s %s %dx%dcolourmono Console: switching consoles %d-%d to %s %s %dx%d to %s unblank_screen: tty %d not allocated ?? <4>selection: kmalloc() failed mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... <3>keyboard.c: do_lowercase was called - impossible <3>do_fn called with value=%d 0123456789+-*/ ,.?()pqrstuvwxylSRQMnnmPQBDCA<6>SysRq: Keyboard mode set to XLATE SAK Resetting Power off Emergency Sync Emergency Remount R/O Show Regs Show State Show Memory Log level set to %d Terminate All Tasks Kill All Tasks Kill ALL Tasks (even init) unRaw saK Boot Off Sync Unmount showPc showTasks showMem loglevel0-8 tErm kIll killalL <6>%sing device %s ... RemountSyncSuperblock not found R/O error %d OK nothing to do <6>Done. %s%dNULL ttyWarning: bad magic number for tty struct (%s) in %s Warning: null TTY for (%s) in %s Warning: dev (%s) tty->count(%d) != #fd's(%d) in %s tty-ldisc-%dCouldn't open N_TTY ldisc for %s --- error %d.tty_check_change: tty->pgrp <= 0! do_tty_hangupdo_tty_hangup: N_TTY open: error %d tty_readtty_writeinit_dev: ldisc open failed, clearing slot %d release_devrelease_dev: bad idx when trying to free (%s) release_dev: driver.table[%d] not tty for (%s) release_dev: driver.termios[%d] not termios for (%s) release_dev: driver.termios_locked[%d] not termios_locked for (%s) release_dev: other->table[%d] not o_tty for (%s) release_dev: other->termios[%d] not o_termios for (%s) release_dev: other->termios_locked[%d] not o_termios_locked for (%s) release_dev: bad pty pointers release_dev: %s: read/write wait queue active! release_dev: bad pty slave count (%d) for %s release_dev: bad tty->count (%d) for %s tty_open<4>tty_io.c: process %d (%s) used obsolete /dev/%s - update software to use /dev/ttyS%d tty_polltty_fasynctty_ioctlUse of setserial/setrocket to set SPD_* flags is deprecated size of tty structure > PAGE_SIZE!/dev/ttyCouldn't register /dev/tty driver /dev/consoleCouldn't register /dev/console driver /dev/ptmxCouldn't register /dev/ptmx driver /dev/tty0Couldn't register /dev/tty0 driver %s: %d input overrun(s) %s: unknown flag %d n_tty_read_chan: called with read_buf == NULL?!? read_chan: tty->pgrp <= 0! n_ttymapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... Warning?!? termios_locked is NULL. <3>%s: irq%d happened with irq_func NULL with %s as cad! mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... memunable to get major %d for memory devs mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... ;n vAMaX ֣d° xmapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... vcsunable to get major %d for vcs devicemapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... eth7eth6eth5eth4eth3eth2eth1eth0loeth%dethether_setup: Ouch! Someone else took %s mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... <7>loopback fed NULL data - splat sunlance.c:v1.12 11/Mar/99 Miguel de Icaza (miguel@nuclecu.unam.mx) LANCELANCE DMAmapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... DMA timeoutTX rings: %d: 0x%8.8x RX rings: RX ptr: %8.8x TX ptr: %8.8x <3>LANCE unopened after %d ticks, csr0=%4.4x. dcsr=%8.8x <6>%s: Memory squeeze, deferring packet. <5>%s: Carrier Lost, trying %s TPEAUI<3>%s: Tx: ERR_BUF|ERR_UFL, restarting <3>%s: again<3>%s: Memory error, status %04x, addr %06lx <3>Lance: Can't get irq %s <5>resetting ledma <3>%s: transmit timed out, status %04x, reset <6>%s<6>%s: LANCE %2.2x%c lebufferbusmaster-regvalburst-sizescable-selection<6>%s: using auto-carrier-detection. optionstpe-link-test?true<5>%s: warning: overriding option 'tpe-link-test?' <5>%s: warning: mail any problems to ecd@skynet.be Can't set AUXIO register on this machine.aui<3>%s: ERROR: Rx and Tx rings not on even boundary. leledmasunqe.c:v2.0 9/9/99 David S. Miller (davem@redhat.com) mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... DMA timeout<3>QuadEther: AIEEE cannot reset the QEC! <3>QuadEther: AIEEE cannot reset the MACE! <3>QuadEther: Cannot reset QE channel! <5>%s: Warning, link state is down. <3>%s: Excessive transmit defers. <3>%s: Carrier lost, link down? <3>%s: Excessive transmit retries (more than 16). <3>%s: Late transmit collision. <3>%s: Transmit fifo underflow, driver bug. <3>%s: Jabber error. <3>%s: Babble error. <3>%s: Transmit descriptor is bogus, driver bug. <3>%s: Transmit late error. <3>%s: Transmit DMA parity error. <3>%s: Transmit DMA sbus error ack. <3>%s: Receive fifo overflow. <3>%s: Late receive collision. <6>%s: Receive packet dropped. <3>%s: Receive buffer too small, driver bug. <3>%s: Receive late error. <3>%s: Receive DMA parity error. <3>%s: Receive DMA sbus error ack. <6>%s: Memory squeeze, deferring packet. <5>%s: transmit timed out, resetting <6>%schannel#ranges<3>QuadEther: Aieee, bogus QEC range for space %08x QEC Global Registers<3>QuadEther: Cannot map QEC global registers. <3>QuadEther: AIEEE, QEC is not in MACE mode! burst-sizesQEC Per-Channel Registers<3>QuadEther: Cannot map QE %d's channel registers. QE MACE Registers<3>QuadEther: Cannot map QE %d's MACE registers. QE Init BlockQE RX/TX BuffersQuadEther<3>QuadEther: Can't register QEC master irq handler. <6>%s: QuadEthernet channel[%d] %2.2x%c qecqesunbmac.c:v1.1 8/Dec/98 David S. Miller (davem@caipfs.rutgers.edu) mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... DMA timeout<3>BigMAC: Cannot reset the QEC. <3>BIGMAC: Transmitter will not reset. <3>BIGMAC: tx_cfg is %08x <3>BIGMAC: Receiver will not reset. <3>BIGMAC: rx_cfg is %08x <3>write_tcvr_bit: No transceiver type known! <3>read_tcvr_bit: No transceiver type known! <3>read_tcvr_bit2: No transceiver type known! <3>bigmac_tcvr_read: Whoops, no known transceiver type. <3>BIGMAC: AIEEE, neither internal nor external MDIO available! <3>BIGMAC: mgmt_pal[%08x] tcvr_pal[%08x] <3>%s: PHY reset failed. <6>%s: Link is now up at %s. 100baseT10baseT<3>%s: Link down, cable problem? <3>%s: Error, cannot re-init the BigMAC. <3>%s: Aieee, link timer is asleep but we got one anyways! <3>bigmac_is_medium_rare: QEC_ERROR, QEC_BMAC_ERROR, BMAC_ERROR, TXD_ERROR, TX_LATE_ERROR, TX_PARITY_ERROR, TX_SBUS_ERROR, RX_DROP_ERROR, RX_SMALL_ERROR, RX_LATE_ERROR, RX_PARITY_ERROR, RX_SBUS_ERROR, RESET <5>%s: Memory squeeze, deferring packet. BIG MAC<3>BIGMAC: Can't order irq %d to go. <3>%s: transmit timed out, resetting <3>%s: Transmitter access conflict. <6>%s<6>%s: BigMAC 100baseT Ethernet %2.2x%c <3>BIGMAC: Device does not have 2 and 3 regs, it has %d and %d. <3>BIGMAC: Would you like that for here or to go? ranges<3>BigMAC: Aieee, bogus QEC range for space %08x BigMAC QEC Global Regs<3>BIGMAC: Cannot map QEC global registers. <3>BigMAC: AIEEE, QEC is not in BigMAC mode! burst-sizesBigMAC QEC Channel Regs<3>BIGMAC: Cannot map QEC channel registers. BigMAC Primary Regs<3>BIGMAC: Cannot map BigMAC primary registers. BigMAC Transceiver Regs<3>BIGMAC: Cannot map BigMAC transceiver registers. BigMAC Init Blockboard-versionBigMAC BufsqecbeDMA timeoutmapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... DMA timeoutmapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt...  scsiX@(hhhPEnclosure Unknown Communications Medium Changer Optical Device Scanner CD-ROM WORM Processor Printer Sequential-AccessDirect-Access NetRAID-4MPERCRAIDTSLPV530FDELLDISKRAIDDGCLDMegaRAIDCDROMTOSHIBAJ.86jaz 1GBiomegaPD-1MATSHITAPD-1 ODX654PLOGICAL VOLUMECOMPAQHSG80DECFastness CryptonCipherIPUBJDCANONMD21/S2 ESDIEMULEXCD-ROM DRM-604XCD-ROM DRM-602XCD-ROM DRM-600PIONEERMJ-5.16SMJ-4.8SNAKAMICH3.10CDX7405LASOUNDCDC-4XREGALMBR-7.4MBR-7NRCI325VMFloptical F*8IINSITEIo20S *FIOMEGACD-ROM CDU-80015.61ScanMaker IIMICROTEKScorpioRELISYS6119CD-R CR-2201CSMITSUMI1.0cCRW6416SCRW8424SCDR1021.00CDR100YAMAHAC2500AC1790A3226C1750AHP6.64CP525SANKYO1.31CDR-H93MV0F0CFIREBALL ST4.3SPD1225S3110LPS525SQUANTUMTEXELRV MMT-2ST/45S2-271.06CD-ROM1.0HCD-R55STEACU07TDC 3600TANDBERGCD-ROM CDU-80121.7xCD-ROM CDU-5611.0iCD-ROM CDU-55S4.3dCD-ROM CDU-541SONY6538ST1581921ST296|jST157NSEAGATE1.20CRD-250SSANYO2.33RO3000SRODIMEV4-2PCA80SCPHILIPS1.0CD-ROM DRIVE:841NEC*4110MICROP2.03RENO CD-ROMX2AMEDIAVISB7BXT-8760SB5AXT-4170SI1.2MXT-1240SB3CXT-4380SPR02XT-3280MAXTOR2.06CDD521/10IMSCR21DK314CCM81DK312CHITACHIVDRD-25XDENONQ14CD-ROM CDS-535H42CD-ROM CDS-431CHINON1.03IMAGERY 2400SPAashimascsi%d : added to blocked host list. scsi_logging_setup : usage scsi_logging_level=n (n should be 0 or non-zero) scsi_luns_setup : usage max_scsi_luns=n (n should be between 1 and 8) Unable to obtain scsi_result buffer scan_scsis: DANGER, no command blocks scsi: unknown type %d Unlocked floptical drive. scsi: scan_scsis_single: Cannot malloc scan_scsis_single: Host queue == NULL No device passed to scsi_request_queueable(). Inactive in scsi_request_queueableNo device passed to scsi_allocate_device(). Attempt to allocate device channel %d, target %d, lun %d No device found in scsi_allocate_device Invalid or not present host. scsi: trying to call schedule() in interrupt, file %s, line %d. scsi.cscsi_free:Bad memory alignmentscsi_free:Trying to free unused memoryscsi_free:Bad offsetscsi_build_commandblocks: want=%d, space for=%d blocks scsi : detected %d SCSI %s%s stotal. scsi_dev_init: DANGER, no command blocks Vendor: %c Model: Rev: Type: %s ANSI SCSI revision: %02x CCS Attached devices: %s nonedumpadd-single-devicescsi singledevice %d %d %d %d remove-single-deviceSCSI DMA pool memory leak %d %d resize_dma_pool: unknown device type %d scsi::resize_dma_pool: WARNING, dma_sectors=%u, wanted=%u, scaling WARNING, not enough memory, pool not expanded Failure to register low-level scsi driverscsi%d : %s scsi : %d host%s. SCSI device not inactive - rq_status=%d, target=%d, pid=%ld, state=%d, owner=%d. Device busy??? Attached usage count = %d scsi_hostadaptermapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... DMA timeoutSun ESP 100/100a/200Too many extra bytes requested Device already registeredFailure to register low-level scsi driverscsi%d : %s scsi : %d host%s. smapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... SCSI device (ioctl) reports ILLEGAL REQUEST. <6>Device not ready. Make sure there is a disc in the drive. SCSI error: host %d id %d lun %d return code = %x Sense class %x, sense error %x, extended sense %x mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... UNKNOWN0x%02x %02x 0x%0x [valid=0] Info fld=0x%x, FMK EOM ILI CurrentDeferredInvalid%s %s%s: sns = %2x %2x ASC=%2x ASCQ=%2x Non-extended sense class %d code 0x%0x Raw sense data:%02x %02xscsi%d : destination target %d, lun %d command = Hostbyte=0x%02x Driverbyte=0x%02x mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... DMA timeoutmapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... $Header: /mnt/ide/home/eric/CVSROOT/linux/drivers/scsi/scsi_error.c,v 1.10 1997/12/08 04:50:35 eric Exp $scsi: trying to call schedule() in interrupt, file %s, line %d. scsi_error.cMissing scsi error handler thread cannot allocate scsi_result in scsi_request_sense. cannot allocate scsi_result in scsi_test_unit_ready. scsi_unjam_host: Miscount of number of failed commands. scsi_eh_%dDMA timeoutmapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... SCSI host %d abort (pid %ld) timed out - resetting SCSI host %d channel %d reset (pid %ld) timed out - trying harder SCSI host %d reset (pid %ld) timed out - trying to shake it loose SCSI host %d reset (pid %ld) timed out again - probably an unrecoverable SCSI bus or device hang. scsi%d: device driver called scsi_done() for a synchronous reset. scsi%d : channel %d target %d lun %d request sense failed, performing reset. Internal error %s %d scsi_obsolete.cscsi%d, channel %d : RESERVATION CONFLICT performing reset. Internal error %s %d status byte = %d scsi: unsupported message byte %d received scsi%d channel %d : resetting for second half of retries. Internal error in file %s, line %d. Stale command on %d %d:%d appears to have died when the bus was reset scsi : aborting command due to timeout : pid %lu, scsi%d, channel %d, id %d, lun %d SCSI bus is being reset for host %d channel %d. DMA timeoutmapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... $Header: /mnt/ide/home/eric/CVSROOT/linux/drivers/scsi/scsi_queue.c,v 1.1 1997/10/21 11:16:38 eric Exp $mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... %s The driver does not yet support the proc-fs Not enough memory to register SCSI HBA in /proc/scsi ! %dHost: scsi%d Channel: %02d Id: %02d Lun: %02d Vendor: %c Model: Rev: Type: %s Unknown ANSI SCSI revision: %02x CCS mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... scsidisk I/O error: dev %s, sector %lu end_scsi_request: buffer-list destroyed sd%csd%c%cdisksdsd.c: linked page request (%lx %x)scsi%d: MEDIUM ERROR on channel %d, id %d, lun %d, CDB: SCSI disk error : host %d channel %d id %d lun %d return code = %x scsidisk: request list destroyedscsidisk: block not lockedsd.c:Bad block number/count requestedsd.cBad block number/count requestedUnknown sd command %d Warning: SCSI DMA buffer space running low. Using non scatter-gather I/O. Warning - running *really* short on DMA buffers Use sg, count %d %x %d maxsg = %x, counted = %d this_count = %d [%p %lx] {%d:%p %p %d} OoopsRan out of DMA buffers.sd.c:Bad block number requestedSCSI disk request error: invalid device. %s: Spinning up disk....not responding... ready %s : READ CAPACITY failed. %s : status = %x, message = %02x, host = %d, driver = %02x %s : extended sense code = %1x %s : sense not available. %s : block size assumed to be 512 bytes, disk size 1GB. %s : sector size 0 reported, assuming 512. %s : unsupported sector size %d. scsi : deleting disk entry. SCSI device %s: hdwr sector= %d bytes. Sectors= %d [%d MB] [%d.%1d GB] %s: test WP failed, assume Write Protected %s: Write Protect is %s onoffUnable to get major %d for SCSI disk Detected scsi %sdisk %s at scsi%d, channel %d, id %d, lun %d removable scsi_devices corrupt (sd)Device busy for revalidation (usage=%d) mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... scsidisk I/O error: dev %s, sector %lu end_scsi_request: buffer-list destroyed mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... CD-ROM I/O error: dev %s, sector %lu end_scsi_request: buffer-list destroyed cdromsrsr.c: linked page request (%lx %x)sr%d: CD-ROM error: command was: <6>sr%d: CD-ROM not ready. Make sure you have a disc in the drive. scsi%d: MEDIUM ERROR on channel %d, id %d, lun %d, CDB: scsi%d: VOLUME OVERFLOW on channel %d, id %d, lun %d, CDB: SCSI CD error : host %d id %d lun %d return code = %03x CD-ROM: request list destroyedCD-ROM: block not lockedsr: can't switch blocksize: in interrupt Unknown sr command %d Warning - running *really* short on DMA buffers SCSI DMA pool exhausted.Bad sr request listWarning: Running low on SCSI DMA buffers Detected scsi CD-ROM sr%d at scsi%d, channel %d, id %d, lun %d scsi_devices corrupt (sr)sr%d: unsupported sector size %d. cartridge changerchangerpop-uptraycaddysr%i: scsi3-mmc drive: %dx/%dx %s%s%s%s%s%s writer dvd-ram cd/rw xa/form2 cdda sr: SCSI DMA pool exhausted.Unable to get major %d for SCSI-CD sr%dmapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... SCSI DMA pool exhausted.<6>sr%d: disc change detected. <6>sr%d: CDROM not ready yet. <6>sr%d: CDROM not ready. Make sure there is a disc in the drive. <3>sr%d: CDROM (ioctl) reports ILLEGAL REQUEST. <3>sr%d: CDROM (ioctl) error, command: srHosed while obtaining audio mode page Hosed obtaining mask for audio mode page (CDROMVOLREAD) Hosed while obtaining audio mode page CDROM does'nt support READ CD (0xbe) command mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... NECCD-ROM DRIVE:25CD-ROM DRIVE:36CD-ROM DRIVE:83CD-ROM DRIVE:84 TOSHIBA<6>sr%d: Hmm, seems the drive doesn't support multisession CD's <6>sr%d: Hmm, seems the cdrom doesn't support multisession CD's <4>sr%d: No finished session <4>sr%d: unknown vendor code (%i), not initialized ? mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... DMA timeoutespRATNSATNTPADMSGACCEPTEDINICMDSEQCOMPTRANSINFORCVCMDSEQRCVDATARCVCMDRCVMSGDISCTRGTCMDCOMPSEQTERMSEQDISCSEQSNDDATASNDSTATUSSNDMSGSLCTATN3DISSELRESELENSLCTRESELSLCTATNSTOPSLCTATNSLCTNATNRESLCTSEQRSTSCSIRSTESPFIFO_FLUSHESP_NOPESP_Unknown%s%s+DMASTATUS<%s,MSG_INunknownMSG-OUTSTATUSCOMMANDDATA-INDATA-OUTTRANS_DONE,TCOUNT_ZERO,P_ERROR,SPAM,IRQ,>INTREG< SLCT_NATN SLCT_ATN RSLCT FDONE BSERV DISCNCT ILL_CMD SCSI_BUS_RESET STEP<%s>CMD_SENT_OKUNKNOWNCMD_BYTES_LOSTNOT_IN_CMD_PHASE1BYTE_MSG_SENTSLCT_ARB_CMPLTUNISSUEDSLCTNORMSLCTSTOPSLCTMSGSLCTTAGSLCTSNEGDATAINDATAOUTDATADONEMSGINMSGINCONTMSGINDONEMSGOUTMSGOUTDONECMDBEGINCMDENDFREEINGCLUELESSABORTONEABORTALLRESETDEVRESETBUSTGTERROResp: what could it be... I wonder...Cannot register ESP SCSI hostNo esp in hostdatanamedmaespdmaCannot find dvma for ESP%d's SCSI esp%d: can't use my espdma ESP RegistersESP registers unmappableESP DVMA Cmd BlockESP DVMA transport area unmappableSparc ESP SCSICannot acquire ESP irq lineesp%d: IRQ %d esp%d: IRQ %s initiator-idscsi-initiator-iddifferentialDifferential clock-frequencySCSI ID %d Clk %dMHz CCF=%d TOut %d burst-sizesNCR53C90(esp100) NCR53C90A(esp100a) NCR53C9XF(espfast) NCR53C9x(esp236) SUNW,espSUNW,fasESP: Total of %d ESP hosts found, %d actually in use. Sparc ESP100 (NCR53C90)Sparc ESP100A (NCR53C90A)Sparc ESP236Sparc ESP236-FASTSparc ESP366-HMESparc ESP100A-FASTBogon ESP revisionSparc ESP Host Adapter: PROM node %08x PROM name %s ESP Model ESP100 ESP100A ESP236 FAS236 FAS100A FAST Happy Meal FAS Unknown! DMA Revision Rev 0 ESC Rev 1 Rev 1 Rev 2 Rev 3 Rev 1+ Rev HME/FAS Live Targets [ %d ] Target # config3 Sync Capabilities Disconnect Wide %d %08lx [%02lx,%02lx] %s yesno%s esp: esp_exec_cmd and issue queue is NULLesp%d: esp_command() called... [tgt<%02x> lun<%02x> pphase<%s> cphase<%s>]esp%d: dumping state esp%d: dma -- cond_reg<%08x> addr<%08x> esp%d: SW [sreg<%02x> sstep<%02x> ireg<%02x>] esp%d: HW reread [sreg<%02x> sstep<%02x> ireg<%02x>] esp%d: current command esp%d: disconnected esp%d: Aborting command esp%d: Resetting scsi bus panicing esp: done() called with NULL esp->current_SCesp%d: Weird, being reselected but disconnected command queue is empty. esp%d: data bad parity detected. esp%d: !BSERV after data, probably to msgout esp%d: yieee, bytes_sent < 0! esp%d: csz=%d fifocount=%d ecount=%d esp%d: use_sg=%d ptr=%p this_residual=%d esp%d: Forcing async for target %d esp%d: Data transfer overrun. esp%d: bogus_data during end of data phase esp%d: Target will not disconnect esp%d: last msg not disc and not cmd cmplt. esp%d: Eieeee, reconnecting unknown command! QUEUE DUMP esp%d: issue_SC[<%02x,%02x>] esp%d: current_SC[esp%d: disconnected_SC[esp%d: got status only, esp%d: and _not_ COMMAND_COMPLETE esp%d: bad parity somewhere mout=%2x esp%d: whoops, disconnect esp%d Disconnect amidst phases, pphase<%s> cphase<%s>, device is bolixed device reset successful device abort successful esp%d: Bizarre bus phase %2x. esp%d: STEP_ASEL for tgt %d esp%d: Failed synchronous negotiation for target %d lun %d esp%d: Warning, live target %d not responding to selection. esp%d: Selection failure. esp%d: Currently -- esp%d: New -- esp%d: resetting bus esp%d: message in mis-carriage. esp%d: target sends identify amidst phases esp%d: msg %02x which we don't know about esp%d: target %d sends a nop esp%d: hoping for msgout FAST-WIDEFASTsynchronous<6>esp%d: target %d [period %dns offset %d %d.%02dMHz %s SCSI%s] -II<6>esp%d: target %d asynchronous esp%d: sending sdtr back, hoping for msgout esp%d: AIEEE wide msg received and not HME. esp%d: AIEEE wide transfer for %d size not supported. esp%d: Aieee, wide nego of %d size. esp%d: rejecting modify data ptr msg esp%d: in do_cmddone() but didn't get BSERV interrupt. esp%d: still in msgout, parity error assumed esp%d: disconnect, resetting bus esp%d: command in weird state %2x esp%d: Gross error sreg=%2x esp%d: No current cmd during gross error, resetting bus esp%d: DMA error %08x esp%d: no command in esp_handle() esp_handle: current_SC == penguin within interrupt!esp%d: illegal command esp%d: Forcing async and disabling disconnect for target %d esp%d: interrupt for no good reason... esp%d: BSERV or FDONE or DC while SCptr==NULL esp%d: SCSI bus reset interrupt esp%d: AIEEE we have been selected by another initiator! esp%d: Reselected while bus is busy esp%d: interrupt engine loses state, resetting bus mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... DMA timeoutU U3#f#UfD"D"3"####$$$""3""""3DDqlogicpti<0>qlogicpti: mbox_command loop timeout #1 <0>qlogicpti: mbox_command loop timeout #2 <0>qlogicpti: mbox_command loop timeout #3 <0>qlogicpti: mbox_command loop timeout #4 <0>qlogicpti: reset_hardware loop timeout <0>qlogicpti%d: Cannot execute ISP firmware. <0>qlogicpti%d: Cannot set initiator SCSI ID. <0>qlogicpti%d: Cannot init response queue. <0>qlogicpti%d: Cannot init request queue. <0>qlogicpti%d: Aieee, firmware checksum failed!<0>qlogicpti%d: Cannot reset the ISP.<0>qlogicpti%d: Cannot stop firmware for reload. qlogicpti%d: Firmware dload failed, I'm bolixed! <0>qlogicpti%d: New firmware csum failure! <0>qlogicpti%d: AboutFirmware cmd fails. <0>qlogicpti%d: could not set clock rate. qlogicpti%d: Fuse returned to normal state. qlogicpti%d: termpwr back to normal state. qlogicpti%d: Fuse is open! qlogicpti%d: termpwr failure qlogicpti%d: You have a single ended device on a differential bus! Please fix! ptispPTI,ptispQLGC,ispqpti%d: Adapter reports no interrupt, skipping over this card.Cannot register PTI Qlogic ISP SCSI hostNo qpti in hostdatanamePTI Qlogic/ISP RegistersPTI Qlogic/ISP registers unmappablePTI Qlogic/ISP Status RegPTI Qlogic/ISP status reg unmappablePTI Qlogic/ISP SCSICannot acquire PTI Qlogic/ISP irq line qpti%d: IRQ %s initiator-idscsi-initiator-idSCSI ID %d burst-sizesclock-frequencyPTISP Response QueuePTISP Request QueueSBUS Qlogic/ISP firmware load failedPTI Qlogic/ISP tmon verification failedPTI Qlogic/ISP cannot be reset(Firmware v%d.%d.%d)isp-fcode(Firmware %s)differential [%s Wide, using %s interface] UltraFastsingle endedQPTI: Total of %d PTI Qlogic/ISP hosts found, %d actually in use. PTI Qlogic,ISP SBUS SCSI irq %s regs at %08lx PROM node %x<0>qlogicpti: Unexpected request queue overflow <0>qlogicpti%d: request queue overflow <0>qpti%d: unknown completion status 0x%04x <4>qlogicpti : Aborting cmd for tgt[%d] lun[%d] <0>qlogicpti : scsi abort failure: %x <4>qlogicpti : Resetting SCSI bus! <0>qlogicisp : scsi bus reset failure: %x <6>cdrom: entering register_cdrom <6>Uniform CD-ROM driver Revision: 3.11 <6>cdrom: drive "/dev/%s" registered <6>cdrom: entering unregister_cdrom <6>cdrom: drive "/dev/%s" unregistered <6>cdrom: entering cdrom_open <6>cdrom: Use count for "/dev/%s" now %d <6>cdrom: entering open_for_data <6>cdrom: drive_status=%d <6>cdrom: the tray is open... <6>cdrom: trying to close the tray. <6>cdrom: bummer. tried to close the tray but failed. <6>cdrom: bummer. this drive can't close the tray. <6>cdrom: bummer. the tray is still not closed. <6>cdrom: tray might not contain a medium. <6>cdrom: the tray is now closed. <6>cdrom: bummer. no disc. <6>cdrom: bummer. wrong media type. <6>cdrom: pid %d must open device O_NONBLOCK! <6>cdrom: wrong media type, but CDO_CHECK_TYPE not set. <6>cdrom: all seems well, opening the device. <6>cdrom: opening the device gave me %d. <6>cdrom: open device failed. <6>cdrom: door locked. <6>cdrom: device opened successfully. <6>cdrom: open failed. <6>cdrom: door unlocked. <6>cdrom: entering check_for_audio_disc <6>cdrom: bummer. tried to close tray but failed. <6>cdrom: bummer. this driver can't close the tray. <6>cdrom: bummer. disc isn't ready. <6>cdrom: entering cdrom_release <6>cdrom: Use count for "/dev/%s" now zero <6>cdrom: Unlocking door! <6>cdrom: entering cdrom_slot_status() <6>cdrom: entering cdrom_number_of_slots() <6>cdrom: entering cdrom_load_unload() <6>cdrom: entering cdrom_select_disc() <6>cdrom: entering cdrom_count_tracks <6>cdrom: track %d: format=%d, ctrl=%d <6>cdrom: disc has %d tracks: %d=audio %d=data %d=Cd-I %d=XA <6>cdrom: entering DVD_LU_SEND_AGID <6>cdrom: entering DVD_LU_SEND_KEY1 <6>cdrom: entering DVD_LU_SEND_CHALLENGE <6>cdrom: entering DVD_LU_SEND_TITLE_KEY <6>cdrom: entering DVD_LU_SEND_ASF <6>cdrom: entering DVD_HOST_SEND_CHALLENGE <6>cdrom: entering DVD_HOST_SEND_KEY2 <6>cdrom: entering DVD_INVALIDATE_AGID <6>cdrom: entering DVD_LU_SEND_RPC_STATE <6>cdrom: entering DVD_HOST_SEND_RPC_STATE <6>cdrom: Invalid DVD key ioctl (%d) <6>cdrom: Received invalid BCA length (%d) <6>cdrom: Received invalid manufacture info length (%d) <6>cdrom: : Invalid DVD structure read requested (%d) <6>cdrom: entering CDROMMULTISESSION <6>cdrom: CDROMMULTISESSION successful <6>cdrom: entering CDROMEJECT <6>cdrom: entering CDROMCLOSETRAY <6>cdrom: entering CDROMEJECT_SW <6>cdrom: entering CDROM_MEDIA_CHANGED <6>cdrom: entering CDROM_SET_OPTIONS <6>cdrom: entering CDROM_CLEAR_OPTIONS <6>cdrom: entering CDROM_SELECT_SPEED <6>cdrom: entering CDROM_SELECT_DISC <6>cdrom: Using generic cdrom_select_disc() <6>cdrom: entering CDROM_RESET <6>cdrom: %socking door. LUnl<6>cdrom: %sabling debug. EnDis<6>cdrom: entering CDROM_GET_CAPABILITY <6>cdrom: entering CDROM_GET_MCN <6>cdrom: CDROM_GET_MCN successful <6>cdrom: entering CDROM_DRIVE_STATUS <6>cdrom: entering CDROM_DISC_STATUS <6>cdrom: This disc doesn't have any tracks I recognize! <6>cdrom: entering CDROM_CHANGER_NSLOTS <6>cdrom: entering CDROMPLAYMSF <6>cdrom: entering CDROMPLAYTRKIND <6>cdrom: entering CDROMVOLCTRL <6>cdrom: entering CDROMVOLREAD <6>cdrom: doing audio ioctl (start/stop/pause/resume) <6>cdrom: entering CDROMPLAYBLK <6>cdrom: entering CDROMVOLUME <6>cdrom: entering CDROMSTART/CDROMSTOP <6>cdrom: entering CDROMPAUSE/CDROMRESUME <6>cdrom: entering DVD_READ_STRUCT <6>cdrom: entering DVD_AUTH <6>cdrom: entering CDROM_SEND_PACKET can't get write perms can't get read perms invalid size given <6>cdrom: entering CDROM_NEXT_WRITABLE <6>cdrom: entering CDROM_LAST_WRITTEN CD-ROM information, Id: cdrom.c 3.11 2000/06/12 drive name: %s drive speed: %d drive # of slots: Can close tray: Can open tray: Can lock tray: Can change speed: Can select disk: Can read multisession: Can read MCN: Reports media changed: Can play audio: Can write CD-R: Can write CD-RW: Can read DVD: Can write DVD-R: Can write DVD-RAM: check_medialockdebugautoejectautocloseinfocdromdevDMA timeoutPCI: Enabling bus mastering for device %02x:%02x PCI: Increasing latency timer of device %02x:%02x to 64 PCI: Unable to handle 64-bit address for device %02x:%02x <3>pci: out of memory. <3>PCI: %02x:%02x [%04x/%04x/%06x] has unknown header type %02x, ignoring. <3>pci: out of memory for bridge. PCI: No PCI bus detected PCI: Probing PCI hardware reverse<3>PCI: Unknown option `%s' %02x%02x %04x%04x %x %08lxdevices%02x%02x.%xpciDMA timeoutnameaddressregWHOOPS: proplen for %s was %d, need multiple of %d fill_sbus_deviceWHOOPS: I got too many register addresses for %s len=%d sbus device register overflowGrrr, I didn't get a multiple of 4 proplen for device %s got %d intrGrrr, I didn't get a multiple of 8 proplen for device %s got %d Device %s has more than 4 interrupts sbusNeither SBUS nor PCI found. io-unitsbisbi not foundiommusbus%d: clock-frequencyClock %d.%d MHz device-idboard#mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... DMA timeoutDMA CONTROL<%08lx> ADDR<%08lx> CNT<%08lx> TEST<%08lx> dma%d: Revision 0 ESC Revision 1 Revision 1 Revision 2 HME DVMA gate array Revision 1 PLUS unknown dma version %x SUNW,fasdmaledmaespdmakeyboard.c: do_lowercase was called - impossible do_fn called with value=%d 0123456789+-*/ ,.?pqrstuvwxylSRQMnn?BDCAoptionskeyboard-click?Unknown Keyboard ioctl: %8.8x keyboard_zsinit: no put_char parameterkeyboard: not present Sun TYPE %d keyboard detected with keyclick without keyclick kbdCould not register /dev/kbd device <6>sunmouse: Successfully adjusted to %d baud. sunmouse: bogon transaction state sunmouseSun Mouse-Systems mouse driver version 1.00 Oops: %s called nop_rs_kgdb_hooknop_rs_change_mouse_baudnop_rs_read_procnop_compute_shiftstatenop_setledstatenop_getledstatenop_setkeycodenop_getkeycodettyX-modettyX-ignore-cdttyX-rts-dtr-offoptions9600,8,n,1,-falseNo serial devices found, bailing out. mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... zs_stopzs_start zs_timer called zs_flush_charszs_writezs_write_roomzs_chars_in_bufferzs_flush_bufferzs_throttlezs_unthrottlezs_ioctlzs_closezs_close: bad serial port count; tty->count is 1, info->count is %d zs_close: bad serial port count for ttys%d: %d zs_hangupzs_openzs_open %s%d, tty overwrite. $Revision: 1.41.2.7 $Sparc Zilog8530 serial driver version %s get_zs bogon zs chip numberZilog Serialcpu-unitbootbusget_zs: couldn't find %dth bootbus obioget_zs no zs serial prom nodezsslaveaddressWHOOPS: proplen for %s was %d, need multiple of %d zilog: address propertyregCannot map zs regs intrzilog: bogon irqsget_zs whee chip not foundget_zs whee no serial chip mappableserialttyScuaCouldn't register serial driver Couldn't register callout driver Zilog8530Unable to attach zs intr tty%02d at 0x%04x (irq = %s) is a Zilog8530 Console: ttyS%d (Zilog8530) mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... serialkbdmouse???PCIO serial driverTI16750ST16650V2ST16650cirrus16550A16550164508250unknownWarning: bad magic number for serial struct (%s) in %s Warning: null su_struct for (%s) in %s su_stopsu_startsu_put_charsu_change_mouse_baud: unknown baud rate %d, defaulting to 1200 su_flush_charssu_writesu_write_roomsu_chars_in_buffersu_flush_buffersu_send_charsu_throttlesu_unthrottlesu_breaksu_ioctlsu_closesu_close: bad serial port count; tty->count is 1, info->count is %d su_close: bad serial port count for ttys%d: %d su_wait_until_sentsu_hangupsu_open%d: uart:%s port:%X irq:%s |RTS|CTS|DTR|DSR|CD|RI baud:%d tx:%d rx:%d fe:%d pe:%d brk:%d oe:%d %s serinfo:1.0 driver:%s $Revision: 1.18.2.7 $<6>%s version %s regsu: no "reg" property su-regssu: cannot map su: loopback returned status 0x%02x su(%s)suttyScuaCouldn't register regular su Couldn't register callout su <6>%s at 0x%lx (tty %d irq %s) is a %s <6>%s at 0x%lx (irq = %s) is a %s namesu_pnpaliaseskeyboardsu_probe: cannot match keyboard and mouse, confused mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... Keyboard failed self testKeyboard interface failed self testKeyboard reset failed, no ACKDisable keyboard: no ACKEnable keyboard: no ACKSet rate: no ACKps2kbd-regspcikbd_init_hw: cannot map keyboard8042: cannot register IRQ %x 8042(kbd): iobase[%08x] irq[%x] 8042kb_ps2pcikbd_init_hw: no 8042 found 8042: cannot register IRQ %s 8042(kbd) at 0x%lx (irq %s) 8042: keyboard init failure [%s] ps2auxpcimouse_init: no 8042 given kdmousemousepcimouse_init: no 8042 found 8042 controllerpcimouse_init: kmalloc(aux_queue) failed. 8042: Cannot register IRQ %s 8042(mouse) at %lx (irq %s) 8042: PS/2 auxiliary pointing device detected. nameps2kbd_probe: no name of root node SUNW,JavaStation-1aliasespcimodelSUNW,sabreebusbeeper<7>OPROMSETOPT%s %s='%s' 2<6>openprom_sunos_ioctl: unimplemented ioctl <6>openprom_sunos_ioctl: cmd 0x%X, arg 0x%lX <6>openprom_bsd_ioctl: cmd 0x%X openprom_ioctl: cmd 0x%X, arg 0x%lX openprom<3>openprom: unable to get misc minor options<3>openprom: unable to find options node rtc<3>rtc: unable to get misc minor frame buffer device<3>fbcon_setup: No support for fontwidth %d <4>fbcon_setup: type %d (aux %d, depth %d) not supported fbcon_redraw_bmove width sy != dysbus%d %s fb%dfbunable to get major %d for fb devs scrollback:map:vc:offdummy device%*.*s%c[@%c%c[@%c%c[@%c%c[@%c%c%c[%d;%dHPROMoptionsscreen-#columnsscreen-#rows%c%c[@%c[@%c[%dH[%dH [%d;%dH[%d@[%d;%dH[%d;%dH[%dP[%d;%dHFIXME: bmove not handled  [%dH[%dM[%dH[%dLSUN8x16nomarginsmargins=font=noblinkCould not allocate sbusfb structure addressheightwidthlinebytesfb%d: %s cgsixcgthree+cgthreecgRDIcgfourteenleobwtwotcxobioemulationmapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... CGsixcgsix_ramcgsix_fbccgsix_teccgsix_thccgsix_daccgsix_fhcsparc68020i386TurboGXTurboGX+GXGX+cgsix at %x.%08lx TEC Rev %x CPU %s Rev %x [%s]mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... bw2_regswidthbw2: can't handle SR %02x BWtwobw2_rambwtwo at %x.%08lxmapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... cgRDIcg3_regsparamsCGthreecg3_ram%s at %x.%08lxcgthreewidthcgthree: can't handle SR %02x mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... tcx-8-bitTCX8TCX24tcx_ramtcx_tectcx_thctcx_dactcx_cplanehw-cursortcx at %x.%08lx Rev %d.%d %s8-bit only24-bit depthmapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... addresscg14 not mmaped Ugh. cg14 iospaces don't match regCGfourteencgfourteen at %x.%08lx, %dMB, rev=%d, impl=%dmapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... Leoleo_ramleo_lc_ss0_usrleo_ld_ss0leo_ld_ss1leo_lx_krnleo_lx_cursorleo at %x.%08lx0123456789abcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZPROMLIB: Bad PROM version %d PROMLIB: Sun Boot Prom Version %d Revision %d memoryavailableregvirtual-memoryidpromadjust_regs: Could not find range with matching bus type... adjust_ranges: Could not find matching bus type... PROMLIB: Aieee, old SBUS driver, update it to use new prom_apply_sbus_ranges interface now! obiorangesPROMLIB: obio_ranges %d keyboardnamedevice_typeserialstdin-pathdisplaystdout-pathnamereg@%x,%xsparc_cpu_modelkernel_thread__global_save_flags__global_restore_flags__global_sti__global_clipage_offsetsparc_valid_addr_bitmapstack_topkernel_flagglobal_irq_holderglobal_irq_lockglobal_bh_lockglobal_bh_countsparc_bh_lockglobal_irq_countsynchronize_irqsynchronize_bhlocal_irq_countlocal_bh_countudelaymstk48t02_regsauxio_registerrequest_fast_irqsparc_alloc_iosparc_free_ioio_remap_page_rangeiounit_map_dma_initiounit_map_dma_page___f___smp_processor_id___f_enable_irq___f_disable_irq___f___irq_itoa___f_mmu_v2p___f_mmu_unlockarea___f_mmu_lockarea___f_mmu_get_scsi_sgl___f_mmu_get_scsi_one___f_mmu_release_scsi_sgl___f_mmu_release_scsi_one_sparc_dvma_mallocsun4c_unmapioaddrsrmmu_unmapioaddrSBus_chaindma_chainsvr4_setcontextsvr4_getcontext_sigpause_commondump_threadidpromprom_root_nodeprom_getchildprom_getsiblingprom_searchsiblingsprom_firstpropprom_nextpropprom_getproplenprom_getpropertyprom_node_has_propertyprom_setpropsaved_command_lineprom_apply_obio_rangesprom_finddeviceprom_getnameprom_fevalprom_getboolprom_getstringprom_apply_sbus_rangesprom_getintprom_getintdefaultromvec__prom_getchild__prom_getsiblingbcopymemscanstrlenstrnlenstrcpystrncpystrcatstrncatstrcmpstrncmpstrchrstrrchrstrpbrkstrtokstrstrstrspn__copy_1page__memcpy__memsetbzero_1page__bzero__memscan_zero__memscan_generic__memcmp__strncmp__memmove__copy_user__strncpy_from_user__csum_partial_copy_sparc_generic__ret_efaultmemcmpmemcpymemsetmemmove__ashrdi3__ashldi3__lshrdi3__muldi3.rem.urem.mul.umul.div.udivschedule_taskflush_scheduled_tasksdequeue_signalflush_signalsforce_sigforce_sig_infokill_pgkill_pg_infokill_prockill_proc_infokill_slkill_sl_infonotify_parentrecalc_sigpendingsend_sigsend_sig_inforequest_moduleexec_usermodehelperget_module_symbolget_optionsdo_mmapdo_munmapexit_mmexit_filesexit_fsexit_sighanddaemonize__get_free_pagesfree_pages__free_pageskmem_find_general_cachepkmem_cache_createkmem_cache_shrinkkmem_cache_destroykmem_cache_allockmem_cache_freekmallockfreekfree_svmallocvfreemem_mapremap_page_rangemax_mapnrhigh_memoryupdate_vm_cacheupdate_vm_cache_conditionalvmtruncatefind_vmaget_unmapped_areazap_page_rangeinsert_vm_structbigphysarea_allocbigphysarea_freebigphysarea_alloc_pagesbigphysarea_free_pagesin_group_pin_egroup_pupdate_atimeget_superget_fs_typegetname__fputigrabiuniqueigetiget4iget_in_useiput__nameilookup_dentryopen_nameisys_closed_alloc_rootd_deleted_validated_rehashd_invalidated_moved_instantiated_allocd_lookupd_pathhave_submounts__mark_inode_dirtyget_empty_filpinit_private_filefilp_openfilp_closefputput_filpcheck_disk_change__invalidate_buffersinvalidate_inodesinvalidate_inode_pagestruncate_inode_pagesfsync_devvfs_permissionpermissioninode_setattrinode_change_okwrite_inode_nownotify_changeget_hardblocksizeset_blocksizegetblkbreadbreada__brelse__bforgetll_rw_block__wait_on_buffermark_buffer_uptodateadd_blkdev_randomnessgeneric_file_readgeneric_file_writegeneric_file_mmapgeneric_readpagefile_lock_tableposix_lock_fileposix_test_lockposix_block_lockposix_unblock_lockdputget_cached_pageput_cached_pageis_root_busyprune_dcacheshrink_dcache_sbshrink_dcache_parentfind_inode_numberis_subdirget_unused_fdvfs_rmdirvfs_unlinkvfs_rename__pollwaitread_cache_pageROOT_DEVinode_generation_countpage_cache_sizepage_hash_tablepage_hash_maskpage_hash_bits__wait_on_pagedo_nfsservctlregister_chrdevunregister_chrdevregister_blkdevunregister_blkdevtty_register_drivertty_unregister_drivertty_std_termiosblock_readblock_writeblock_fsyncwait_for_requestblksize_sizehardsect_sizeblk_sizeblk_devis_read_onlyset_device_robmapsync_devget_blkfopsblkdev_openblkdev_releasegendisk_headresetup_one_devunplug_devicemake_requesttq_diskfind_bufferinit_buffermax_sectorsmax_segmentsmax_readaheadtty_hanguptty_wait_until_senttty_check_changetty_hung_up_ptty_flip_buffer_pushtty_get_baud_ratedo_SAKconsole_printregister_filesystemunregister_filesystemregister_binfmtunregister_binfmtsearch_binary_handlerprepare_binprmcompute_credsremove_arg_zerolookup_exec_domainregister_exec_domainunregister_exec_domainregister_sysctl_tableunregister_sysctl_tablesysctl_stringsysctl_jiffiessysctl_intvecproc_dostringproc_dointvecproc_dointvec_jiffiesproc_dointvec_minmaxrequest_irqfree_irqbh_activebh_maskbh_mask_countbh_baseadd_timerdel_timermod_timertq_timertq_immediatetq_schedulertimer_activetimer_tabletqueue_lockwaitqueue_lockprobe_irq_onprobe_irq_offautoirq_setupautoirq_reportrequest_dmafree_dmadma_spin_lockcheck_regionrequest_regionrelease_region__wake_upsleep_onsleep_on_timeoutinterruptible_sleep_oninterruptible_sleep_on_timeoutscheduleschedule_timeoutjiffiesxtimedo_gettimeofdayloops_per_jiffykstatpidhashpanicprintksprintfvsprintfkdevnamebdevnamecdevnamesimple_strtoulsystem_utsnameuts_semsys_call_tablemachine_restartmachine_haltmachine_power_offregister_reboot_notifierunregister_reboot_notifier_ctypesecure_tcp_sequence_numberget_random_bytessecurebitscap_bsetsetup_arg_pagescopy_stringsdo_execveflush_old_execopen_dentryread_execsi_meminfoset_writetimesys_tz__wait_on_superfile_fsyncclear_inoderefile_buffernr_async_pages___strtokinit_fifofifo_inode_operationschrdev_inode_operationsblkdev_inode_operationsread_aheadget_hash_tableget_empty_inodeinsert_inode_hashremove_inode_hashmake_bad_inodeis_bad_inodeglobal_event__down__down_interruptible__down_trylock__upbrw_pageadd_mouse_randomnessfasync_helperdisk_nameget_write_accessput_write_accessregister_consoleunregister_consoleget_fast_timestrnicmpinit_task_union_stext_etextmodule_listproc_sys_rootproc_registerproc_unregistercreate_proc_entryremove_proc_entryproc_rootproc_root_fsproc_get_inodeproc_dir_inode_operationsproc_net_inode_operationsproc_netproc_busproc_scsiproc_scsi_inode_operationsdispatch_scsi_info_ptrproc_openprom_registerproc_openprom_deregisterlockd_uplockd_downnlmclnt_procnlmsvc_invalidate_clientnlmsvc_opslockdctlnlmsvc_grace_periodnlmsvc_timeoutnlm4_lck_denied_grace_periodnlm4_lck_deniednlm4_lck_blockednlm4_rofsnlm4_stale_fhnlm4_grantednlm4_deadlocknlm4_failednlm4_fbignlm4_lck_denied_nolocksregister_nlsunregister_nlsunload_nlsfind_nlsload_nlsload_nls_defaultutf8_mbtowcutf8_mbstowcsutf8_wctombutf8_wcstombsdev_lockctskb_over_panicskb_under_panicsock_registersock_unregistermemcpy_fromiovecmemcpy_tokerneliovecsock_createsock_allocsock_releasesock_setsockoptsock_getsockoptsock_sendmsgsock_recvmsgsk_allocsk_freesock_wake_asyncsock_alloc_send_skbsock_init_datasock_no_dupsock_no_releasesock_no_bindsock_no_connectsock_no_socketpairsock_no_acceptsock_no_getnamesock_no_pollsock_no_ioctlsock_no_listensock_no_shutdownsock_no_getsockoptsock_no_setsockoptsock_no_fcntlsock_no_sendmsgsock_no_recvmsgsock_rfreesock_wfreesock_wmallocsock_rmallocsock_rspaceskb_recv_datagramskb_free_datagramskb_copy_datagramskb_copy_datagram_iovecskb_realloc_headroomdatagram_pollput_cmsgnet_familiessock_kmallocsock_kfree_sskb_queue_locksk_run_filterneigh_table_initneigh_table_clear__neigh_lookupneigh_resolve_outputneigh_connected_outputneigh_update__neigh_event_sendneigh_event_nsneigh_ifdownneigh_sysctl_registerpneigh_lookuppneigh_enqueueneigh_destroyneigh_parms_allocneigh_parms_releaseneigh_rand_reach_timeneigh_compat_outputdst_alloc__dst_freedst_totaldst_destroynet_ratelimitnet_randomnet_srandom__scm_destroy__scm_sendscm_fp_dupfiles_statdo_mknodmemcpy_toioveccsum_partialmake_8023_clientdestroy_8023_clientmake_EII_clientdestroy_EII_clientsklist_destroy_socketsklist_insert_socketscm_detach_fdsinet_add_protocolinet_del_protocolrarp_ioctl_hookip_route_outputicmp_sendip_options_compilearp_sendarp_broken_opsip_id_countip_send_checkip_fragmentinet_family_opsin_atonip_mc_inc_groupip_mc_dec_group__ip_finish_outputinet_dgram_opsip_cmsg_recv__release_sockinet_addr_typeip_rt_ioctldevinet_ioctlip_statisticsinet_stream_opsinet_releaseinet_stream_connectinet_dgram_connectinet_acceptinet_pollinet_listeninet_shutdowninet_setsockoptinet_getsockoptinet_sendmsginet_recvmsgtcp_ehash_sizetcp_ehashtcp_listening_hashtcp_bhash_sizetcp_bhashudp_hashdestroy_sockip_queue_xmitmemcpy_fromiovecendcsum_partial_copy_fromiovecendnet_timerudp_ioctludp_connectudp_sendmsgtcp_closetcp_accepttcp_write_wakeuptcp_read_wakeuptcp_write_spacetcp_polltcp_ioctltcp_shutdowntcp_setsockopttcp_getsockopttcp_recvmsgtcp_send_synacktcp_check_reqtcp_reset_xmit_timertcp_parse_optionstcp_rcv_establishedtcp_init_xmit_timerstcp_clear_xmit_timerstcp_slt_array__tcp_inc_slow_timertcp_statisticstcp_rcv_state_processtcp_timewait_state_processtcp_do_sendmsgtcp_v4_rebuild_headertcp_v4_send_checktcp_v4_conn_requesttcp_create_openreq_childtcp_bucket_create__tcp_put_porttcp_put_porttcp_inherit_porttcp_v4_syn_recv_socktcp_v4_do_rcvtcp_v4_connectnet_reset_timernet_delete_timerudp_prottcp_prottcp_openreq_cachepipv4_specifictcp_simple_retransmittcp_transmit_skbtcp_connecttcp_make_synacktcp_tw_death_row_slotsysctl_local_port_rangetcp_port_roverudp_port_rovertcp_sync_mssnet_statisticsxrlim_allowtcp_write_xmitdev_loopback_xmittcp_regssysctl_max_syn_backlogsysctl_ip_always_defragnetlink_set_errnetlink_broadcastnetlink_unicastnetlink_kernel_createnetlink_dump_startnetlink_acknetlink_attachnetlink_detachnetlink_postrtnl_waitrtnl_rlockctrtnl_lockrtnl_unlockipv4_configdev_openin_ntoaip_rcvarp_rcvarp_tblarp_findregister_netdevice_notifierunregister_netdevice_notifierregister_inetaddr_notifierunregister_inetaddr_notifierloopback_devregister_netdeviceunregister_netdeviceregister_netdevunregister_netdevnetdev_state_changeether_setupdev_new_indexdev_get_by_indexeth_type_transinit_etherdevdev_set_allmultidev_set_promiscuitysklist_remove_socketeth_copy_and_sumalloc_skb__kfree_skbskb_cloneskb_copynetif_rxdev_add_packdev_remove_packdev_getdev_allocdev_alloc_namedev_ioctldev_queue_xmitnetdev_droppingdev_basedev_closedev_mc_adddev_mc_deletedev_mc_uploadn_tty_ioctltty_register_ldisckill_fasyncif_port_textsysctl_wmem_maxsysctl_rmem_maxltalk_setupqdisc_destroyqdisc_resetqdisc_restartqdisc_headqdisc_create_dfltnoop_qdiscregister_gifconfregister_firewallunregister_firewallcall_in_firewallcall_out_firewallcall_fw_firewallregister_8022_clientunregister_8022_clientregister_snap_clientunregister_snap_clientip_masq_get_debug_levelip_masq_newip_masq_listenip_masq_free_portsip_masq_out_getip_masq_in_getip_masq_putip_masq_control_addip_masq_control_delip_masq_control_getip_masq_user_hookip_masq_state_nameip_masq_select_addr__ip_masq_lockip_masq_m_tableip_masq_s_tableip_masq_d_tableregister_ip_masq_appregister_ip_masq_app_typeunregister_ip_masq_appip_masq_skb_replacerpc_allocaterpc_freerpc_executerpc_new_taskrpc_init_taskrpc_release_taskrpc_sleep_onrpc_wake_uprpc_wake_up_nextrpc_wake_up_taskrpc_wake_up_statusrpc_new_childrpc_run_childrpciod_wake_uprpciod_downrpciod_uprpc_create_clientrpc_destroy_clientrpc_shutdown_clientrpc_killall_tasksrpc_call_syncrpc_call_asyncrpc_call_setuprpc_clnt_sigmaskrpc_clnt_sigunmaskrpc_delayrpc_restart_callxprt_create_protoxprt_destroyxprt_set_timeoutrpcauth_registerrpcauth_unregisterrpcauth_init_credcacherpcauth_free_credcacherpcauth_insert_credcacherpcauth_lookupcredrpcauth_bindcredrpcauth_matchcredrpcauth_holdcredrpcauth_releasecredsvc_createsvc_create_threadsvc_exit_threadsvc_destroysvc_dropsvc_processsvc_recvsvc_wake_upsvc_makesockrpc_proc_initrpc_proc_registerrpc_register_sysctlrpc_proc_unregisterrpc_proc_readsvc_proc_registersvc_proc_unregistersvc_proc_readxdr_encode_stringxdr_decode_stringxdr_decode_netobjxdr_encode_netobjxdr_zeroxdr_onexdr_twoxdr_shift_iovecxdr_zero_iovecrpc_successrpc_garbage_argsrpc_system_errrpc_debugnfs_debugnfsd_debugnlm_debugio_request_lockend_that_request_firstend_that_request_lastblkelv_ioctlloop_register_transferloop_unregister_transfermd_sizemd_maxreadaheadregister_md_personalityunregister_md_personalitypartition_namemd_devmd_errormd_register_threadmd_unregister_threadmd_update_sbmd_mapmd_wakeup_threadmd_do_syncmisc_registermisc_deregistercolor_tabledefault_reddefault_grndefault_bluvideo_font_heightvideo_scan_linesvc_resizefg_consoletake_over_consolegive_up_consoleset_selectionpaste_selectionhandle_scancodekbd_ledfuncscsi_register_modulescsi_unregister_modulescsi_freescsi_mallocscsi_registerscsi_unregisterscsicam_bios_paramscsi_partsizescsi_allocate_devicescsi_do_cmdscsi_command_sizescsi_init_mallocscsi_init_freescsi_ioctlprint_commandprint_senseprint_msgprint_statusscsi_dma_free_sectorskernel_scsi_ioctlscsi_need_isa_bufferscsi_request_queueablescsi_release_commandprint_Scsi_Cmndscsi_block_when_processing_errorsscsi_mark_host_resetscsi_ioctl_send_commandscsi_sleepproc_print_scsidevicescsi_hostlistscsi_hostsscsi_devicelistscsi_device_typescdrom_get_next_writablecdrom_get_last_writtencdrom_count_tracksregister_cdromunregister_cdromcdrom_fopscdrom_number_of_slotscdrom_select_disccdrom_mode_selectcdrom_mode_senseinit_cdrom_commandpcibios_presentpcibios_read_config_bytepcibios_read_config_wordpcibios_read_config_dwordpcibios_write_config_bytepcibios_write_config_wordpcibios_write_config_dwordpci_read_config_bytepci_read_config_wordpci_read_config_dwordpci_write_config_bytepci_write_config_wordpci_write_config_dwordpci_devicespci_rootpci_find_classpci_find_devicepci_find_slotpci_set_masterpci_proc_attach_devicepci_proc_detach_devicepcibios_find_classpcibios_find_devicepci_resource_lenfb_displayfbcon_redraw_bmovefbcon_dummyfb_confb_alloc_cmapfb_copy_cmapfb_get_cmapfb_set_cmapfb_default_cmapfb_invert_cmapsregister_framebufferunregister_framebufferfbcon_cfb8fbcon_cfb8_setupfbcon_cfb8_bmovefbcon_cfb8_clearfbcon_cfb8_putcfbcon_cfb8_putcsfbcon_cfb8_revcfbcon_cfb8_clear_marginsfbcon_mfbfbcon_mfb_setupfbcon_mfb_bmovefbcon_mfb_clearfbcon_mfb_putcfbcon_mfb_putcsfbcon_mfb_revcfbcon_mfb_clear_marginssun4c compatabilitycompatibleSparc-Linux sun4 needs a specially compiled kernel, turn CONFIG_SUN4 on. Sparc-Linux sun4e support does not exist A hh 8( Linux(none)2.2.19#1 SMP Mon Apr 2 13:47:58 EDT 2001sparc(none)r  @@ @@ D  6PROM2P"28!2 #2$1Q1R1S1T1U1xV1`W1Hq10r1s1ST4 ` S"<g"dS"PTXSS# SXj7kPTp̰Tdt"4""4SS_̰mS~l̰F4U4SSLSXPS̰SuvltSd̰xSxDSSlTS\(SSS^Th@TSSSSSSSS~Sl<SecL\L̰SSS tl̰SSSSz{`S!"SSSl̰̰S,V4SStzSMSZN(SSSSS`tSSSSSSDqPSSSwHSSSSS"xTXkPpTS DQSSSPdTUlSHs;`GSopTTdSSS_`bdc|&8'P&&T())**tgt @SStTCDC  =`6,(6,6,6,6,06,S6,6,6,6,6,6,6,6,Xj6,kPT6,6,6,6,H6,6,6,46,(OX_6,mS~l6,F4U6,6,++&\+XP,6,- uvlt<d6,xy<xD.h8l78\(G 8H^G4Ft6, pJ $6,I.p/$T0T 6,~KL6,D@E< ecL\L6, l d  tlT6, >6,z{`>6,6,6, 6,6,l6,6,3,V46,6,tz6,M6,;4N(@A(B >t6,0t6,6,6,6,6,6,6,qP7l6?H506,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,6,@77h787 66666666p66666P666666668666666666 5:::h:H:0::9999h9@988888h888 7 7 7 7 7 7 7 777  8   AdAlAˤAˤHHGGHHHxHhHX  '@ __^^^^`@ a0E`Hc`$($(, xhllҌҰxhmphmhmu,hm@hmlhmPhm|i@$i^@$i@$ip@i`!@iXiHi8~i(,i piih h$!h4"h T)h Lt  P&hj j$t,ii i i  i ij $j $j8jx $jh( jXx$ jH|j8 $j( j $/sbin/modprobek@k0k2DH@l:@: @ @sHs@s0s ssrrrrrrr(XOm(( sP  0` <K  |(@ \ dddp``PH@0@PH@@80 ( <,4T,4T$\4t\4,t4T$\t4t\t4 ( 8  -    %%%%%%%%%%%%%% 4%%%%%%%%%%%%%%%%%%%2=B M@@PHGH8X `(%L6\M8DhTSX\3nD%xkPkd<ɨlHD܈@ AmH(Am0< @AmHHX$$L`$$Lh$$Lp%tx$$L$$L @# $$L$$L$$L$$L $$L ȁ$$L ؁$$L)Am$$L$$L$$L $$L!$$L $$L($$L0##8$$L pAm\Hx$$L!P!!!A@"x $L $$L $$L $$L $$Ё$$L`$ ( ($!!\"<T \ "  #d.$0$1p1181T%84243H%S;O>h>>>>?>?88G6\Dh'3P^H';4o(oqrrr~sX(-d0l (( s H ),004 H)ӰҐTX\4Ԅ,ϸ0d(dd,H ??BBEEFFGG' ' ' ' ' '''ڈ4xdHhHdHX4Hh 8 (pL4xTH\@h< <@<@ٸX<D٨\@٘h< و8(x| +ڨHޘ ވ ޸ ި L-----P  $ h            `   .@`   2  2X ( 4X H 6D  :l` ?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~> , |         @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ 6`E {   =6\ >@Dh CLFt3 VP ߀ f wp w w Ƽ Ĩ  ( ˤ HG t ,  H 8 t   LEE228P( I  I$ xI( hI, PK @Oޘ  0Oޘ  I0       ,$$ b`.d t&&&p&`&Hޘ&0ޘ& ޘ& & % % % %ޘ%%%%m%mm%xmO noop Pnoqueue Ppfifo_fast$ T , d(P(H(@ _.p..p .u0p(((((((((p(h(P(@(`     H/ //0$ u0p d`  ( t  u0}E@(3h   3XTxޘ3HT|ޘ38T3(T3Tޘ3Tޘ2Tޘ 2T 2T 2T 2T 2T2T2Tޘ :p =\ 'W:x mh ]X: X:X0:::@ I_X?I_\ImU(AIgd \N0N(N  Ph  Px 1| R$ < R$ =,d  %HJNQpQSdcFc( &x & &Y8^p %HJLQp &HS :c &hc( &x & &UP\HW pޘWpޘWp %pt<uL &@ &Hu : &` &h &p &x & &~D,p( %\ &8 &@ &H :@ &h &p &x & & %\ &8 &@ &HD :@ &h &ph & &trprpii i(rst +\+,,P,d,l,,u@--|-/@/T041t1[l\8b b (bbbbbbs`sHsPsl`sl`sl`sl`QmsmIHmpmQmOmg|dlvDv`c^l0 p(w\ti0$$L3@d,P, ,@d,(,p(,S,   d,S,(, S,  (, S,( (, S,( (*P `PT P*P P*P (#P P#P @Pl$PCTx`'PC(p @P%h P `4 )%.Xh R%.P R%H tR% @H *%.8| S%.0 S%( S%   P  PP P , P.P (P%[,P%[0P%c`P@ P%. P,z @$@@@Jp@@)+'@%1DFX'@-&H!&(%K&H&(%&H#&(L ABC@ E F G H I J KL@@X@X@4@4 T@  V@ X Z Yf f|Tgg@i0ln 0w ww3wwMx px LL LLLwwxwh ` XPNHw0wwwx0xc^lvLyypi0      #+3;CScscc !1Aa  0@` ??   `  UUUUUUUUUUUUUttyX6,{@$,&$#&d$%''*D**$+<$###$/!PL""###h < #,O`'^~",0H`;CDXc4UXZ;;;;;X2Kn,X `%K,X `T4rs Pp}T} ȄpȄ„Ðl@HȄĐlPH$lPdP֨Lװ(֨װ<  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*!!!!/%123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%%$ $ $ $ %$ %%% %%<%%%$%4%,%"d"e"`&:&;&e&f&c&` "%%%&B&@&j&k&<%%! <%!!!!!"!%% !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~# #%%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%"")"a"e"d# #!"H"" %  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~&:&;&e&f%&c&` "%%%&B&@&j&k&<%%%%! <%!!!!!"!%% !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJK!*LMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~#!+ #%%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%!&"")"a"e"d# #!"H"" %1234567890-= qwertyuiop[]asdfghjkl;'`\zxcvbnm,./      <   !@#$%^&*()_+ QWERTYUIOP{}ASDFGHJKL:"~|ZXCVBNM<>?     >     @${[]}\qwrtyuiop~sghjklzxvnm    |                   1234567890-= qwertyuiop[] asdfghjkl;'`\zxcvbnm,./      <              [[A[[B[[C[[D[[E[17~[18~[19~[20~[21~[23~[24~[25~[26~[28~[29~[31~[32~[33~[34~[1~[2~[3~[4~[5~[6~ !'-38=BGLQU`A`a'A'a^A^a~A~a"A"aOAoa0A0aAAaaAEae,C,c`E`e'E'e^E^e"E"e`I`i'I'i^I^i"I"i-D-d~N~n`O`o'O'o^O^o~O~o"O"o/O/o`U`u'U'u^U^u"U"u'Y'yTHthss"yszijD@oHloPPoX4o`ohopoxoˀpd̠( xh`XPH@80@( xh`XPH @( xh`PH8H(xxph`XPHX@8X08( (( (HHx`HX@HX8H0(H0 HHHHHHHxHphH@`PHH@H8(H@HH!HHH@H@H@HHXpH H< 4xΈψdD'!<%H(+c^l0|$i04+XP   J UWhJtY@(8`\9@_`balabcLjT$        'Am@ABCDEFG !x"p#h$`%P'H(@)8*0+ tth0d@,0@@@h$( )PAmc^l0C|L$!C4)xC8)xC<)xC@)xCxD)xCmlCmT-.0P\_E$$L2H{@DFDPGEpFPHTHJKKtDD4D4D4D4D<>?L$/B@@>??tBCC$? C`D@AhC@1234567890-=`=/*. qwertyuiop[]789-asdfghjkl;'\ 4560zxcvbnm,./ 123 6D|}~z{YxZ[\]^_|y`abcdqrstuefghi|jvklmno}~p6O`'^~",JJ0JHN0OR RdX XhQ    1234567890-=`=  qwertyuiop[] asdfghjkl;'\zxcvbnm,./    !@#$%^&*()_+~=  QWERTYUIOP{} ASDFGHJKL:"| ZXCVBNM<>?  @${[]}\= qwrtyuiop~ sghjkl zxvnm     =       =          1234567890-=`=  qwertyuiop[] asdfghjkl;'\ zxcvbnm,./      =       ```````[[A[[B[[C[[D[[E[17~[18~[19~[20~[21~[23~[24~[25~[26~[28~[29~[31~[32~[33~[34~[1~[2~[3~[4~[5~[6~hhmrw|ЁЇЍГЙПХЫбзн`A`a'A'a^A^a~A~a"A"aOAoa0A0aAAaaAEae,C,c`E`e'E'e^E^e"E"e`I`i'I'i^I^i"I"i-D-d~N~n`O`o'O'o^O^o~O~o"O"o/O/o`U`u'U'u^U^u"U"u'Y'yTHthss"yszijD__bcH___dK dPdpe(eHeheeFP@ P2Kn,X `%K,ttyS RRRRRS8S0S(S SSSR R@S@Sx2Kn,X `%KttySp||}~z{YxZ[\]^_|y`abcdqrstuefghi|jvklmno}~p1234567890-= qwertyuiop[] asdfghjkl;'`\zxcvbnm,./* 789-456+1230 /t`LZHZH$0p\x ] y0yPyp`%(D*259=977=T=T=T=T=T=TUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU$4Tt>EFJxOP$PRpRT UUW WXtXZL[h\4],]^P^\^^^^^^^^^^^^O!ab ffTcHjkibLkkoToTo8~~~~l|88||8<<<<~~<<<><~~<fffffffff{|`8ll8 |<~~<~<~~< 0``0$ff$88||||88<<<fff$lllllll||| 0`Ɔ8ll8vv000` 000000 0 0f<l8l||||`0||0xv`0v~ x|||~~8ld`````f<ff|bfofff~p0`x |v 08<0`||0`vvffffffv~8ll8|0000`|0`Λ 0fΖ><<<6ll6l6lDDDDDDDDUUUUUUUUwwwwwwww66666666666666666666666666666666666666666666666666666666666666666666666666666667666666666666670??07666666666666666666666666667076666666666666666666666666666666666666666666??66666666666666666666666vvxlllllll`00`~pfffff|``v~ffff<~~~~`0``|```0|~0  0~ 0`0 ~p~vv8ll8 ll<lllllp0`|||||||`0 @P@P@ X p plvv4vP|h},w~(qLppppp p@0pP0p`p`$ (08pp p@ppp @ `00 @@P` ``p  @(((((AAAAAABBBBBB   /obio/su@?ِ?ۤ?ڔ??? ??W?V?Y?됖?됒?두?뒐?볢?벒?뵒?붐????R?T?V?X?d?x?z?쑐?쐒?옐?왐?욐?њ?ј?3?5?7?9?E?Y?[?\?^?g?n?w?z?????Ӡ?Ԕ?Ւ?ې?ߒ??? ? ?"?#?%?;?=?@?B?D?F?H?K?M?P?R?T?e?g???Ր???? ? ?(?*????????????’?Ē?Ŕ?Ɛ?7?C?N?]?Ԓ?’?Ē?ƒ?Ɣ?????  $???????????ג?ې?ے?ܒ?ܔ???????A?_?P????2? ? ? ? ܰ? ? ? ? ? ? ? ? &? ? ? ? ? ’?!?R???L?N?P?r?u?z?Đ?ސ???????=?=?=?T?Ty?T?T?[Æ?[͐?[֐?\D?\N?\W?a?c?d ?d&?dV?dv?d?d?d֒?d?e?e?e)?e@?e?lђ?m ?o?o2?s?s?s?t?uB?u?u?v?v?w&?w?wؒ?x?x@?xJ?x?x?xĒ?xҒ?x?y?y ?y`?yo?y?y?z?z?z?{?{?{(??????Đ???y?ܝ?ᝐ?˰?۰???M?e?ɐ?ϐ?Ԑ??T?[?a?s?Ӓ???F?K?? ? ? ? ? ? ? ? ? ? ? ”? Ô? Ĕ? Ŕ? Ɣ? ǔ? Ȑ? Ȕ? ɔ? ˔? ̔? ͔? Δ? ϔ? Д? є? Ҕ? Ӓ? ݐ? ސ? ߒ? ? ? ? ?C?u?%V?a?a?b?b9?ؒ?;?<?>?>?B?B?D??E?FK?O?O?P?P??f?w?s????>?[???a???#?ز?Đ?~?擄?? ? ]? m? ? ?1?C?'=?'c?ZN?ZŒ?fͰ?k?kư?kӰ?kݰ?k?l?l?l/?N?d?ذ???Ȱ?ސ??ɐ?ф?F?%?J?M?h??R?\?f?s?y?? ? ??? ?&??n???4?O?ب?䬐??I?ϐ?J?Y?g?u?鍐?閐?鞐?馐?鮐??ɐ?ѐ?ِ?? ????0?6?8?A?G?M?S?i?w?}??????#?)???M?S?k?u?~?퇐?퐐?????Ԑ???0?W?/?B?????ΐ???c?,?9???h?ʐ????ɐ?ϐ?֐?ݐ???O?w???Ӓ??ΐ??!?A??C?W?n?ѐ?Ж????(Ԑ?)?)?)ΐ?+?+ ?+?J;?J@?JE?JQ?Jl?J?Jְ?J?K?Xh?X?=?Q?h?|????̐??????5?=??ð?ΰ?ٰ?v???͇?͌?͑?͘?Ő?̐?Ӑ?ݐ?"`"`"`"` ` ` `` ` @( "  `"*  㿘=u sqo m`k`i`g`e`c ?``` ```` `    " < @H   $  ! ! ! * (`"݆  `)*` : (@̐"() (!)    00 @  " "   0 @ " " T8@X@L\l(4@L,Xhdp|04DT<H$,@4<DLT\d@lTt|0dp $4$D,X4h<|DLT\dplt|hxDT(8 $0$<,4@<xDPɤ\hd|p͐|͜0LX\L$ $08@HPX`lhxtT!"$"\#d##.$0 $0H,0h40<0D2XL2T3\3d3ll4t5|8H8PIIIJJJOTXTTTU U m0$0<HMdTO8\OdOpl|xllnnntT<DX  `$L,4<ʀH\T(`Πlxt X<ݨ(D X$,8@<L\T`ht$9:xrrh <2< p #L  %<,< ,   : V cL, <R<R c$"@ <:`" a# H/`@<R" #a " " @" 㿘< h<D "a8   "a8a8 * a8<"H*`h &<`0 P`4%<3?)<!h ȑ* *`Ң!l - !h*   !l 8B !h*`@E 2!hH<!<c!"!"`"`< <c " "`"`<#<d#"#"`"`< <d " "`"`< <d " "`"`<!|<d!|"!|"`"`<.< <#<d#"#`"`"`<"<d"""@"`"`<<d А "`"`zTz`zlzxzzzz㿘. >  h< s d*`< *`<<a "a<a  "a!<#`t€ "7:`㿘'DJ@ \!</ N  D 'DN`  DJ K -'DJ? "=DJ@`'DDJ@ 5 2`2 Ȑ AD<JJb(b( JK @ ` JK @ `   "DDJ  a b <<<a<"aפ"8 Da<"aל"`D79"D 'D<JJbb JK @ ` JK @ ` ה  DD<`'DJ`J@` JK @ ` JK @ ` K J"  < <$",M"DJ""J   JK @ ` JK @ ` K J"  < <$",'"vDJ##J   JK @ ` JK @ ` K J"  J`</<b <x`   * J`` 2*, #! <#b,:$",<JcJc``JK ``JK  ``JK "@`DDD  <D"J@KkM* m2 D* `"'DD'DJ@  `DJ@  㿘<< @n"b< &M#<,`<< ",< c χ "$b,<c(π < $b,c0x < $b,c8p < $b,c@h < $b,`cH 2< $b,<6#Pb,`( <"̓*` €< #X< #`<#h<#p<#x5 <w<5#<w</6Ɛ"<#5ؠ <w<5Ӑ#<w<b#"a & @lb, @$@<ao p 5&@< L<`<@!<@< <a<@<a1<a'<@+<p-</%<)</<H7;</<7o!b    @ " ""#`@"" 2`@< &<a@<@!<@< <a<@<a1<a'<@+<p-</%<)</<H7;</  <.al ?"al : + 2 *`@  '21&";<ܐ# @"b<@$"<@ <" "b  <#5B $""@ @ "<a/ " 0&@";#@ b,  "@$"&"8cH@O@&@, "C$   !> 6 6!8 ԣ` `*$`` ``  ` ` `<H#$ < < =$ !9   $! !@Om ! !@Og ! !<, 耢 " !R?<4 @ ` !  դ<  hqp<"`p?b0"`p" p "$"'! </"  #<x <<  *bxQ bh4{0 <"ђ } 4mbh  ` `  㿐!<D!< ~ !!ai <aئ <a8ѣ   <H<(!a!<2$#<< @  X # "@<"0ͿH<"`H L` D c "`<"pͬX<T *☘ 2 c "`<"͚d<`*    c $<ܐ#͈#< ?cHх$ $Ƀ/7<V#<# "a a"` "`"` # A`@<ccH"d ?<2#/7@`"`ɡ 2` `c`""P`""T<#P0;㿘!<2#<#0-# @* b#@" D#@" XЭ  " !<!!@  `@и  㿐<2#``<["<p!T V -<+<   ,*` ? 2 ``*` f^` ( / ` 7fg  bX / ` 7fU  "? }O ""  `$ u   @㿘<w<(b," * 2   #b,@"<:#! << "`,"@ "<2#$4@#"#<c <2, # ƖА  <"ɒuH*/ <!<!"!p"`"`< < "  "`"`<!<<!<"!<h"`"`<!<!"!"`"`<#<#"#"`"`< < " "`"`< < " "`"`<!|<!|"!|"`"`<<</` ` </al0 @H`  <a@@@Q0/` `<``<ƈ0  </al0@H`  <a@@@b0<.<4*  㿘@z@z<3 "`@z@y㿘<",`@l@㿘##<3 `@y,`@y<3 <3`(@y @ @ ː@y@y@<!Đ z@y@y-<3!<</<H<3l@  ,`  l @ @p@ "p"`&pp`܀`" ܀ @y@yH*/ 㿘<.,"`<`  7<3%<2`| "@@ ?H*/ L @ &  *`@ @# <! ?,``"`,`<#4 ?,``"`$,`<3 <`+ @ <a+ <3" `(, <"#4!(<3' `<3 @y2 @@@y,L  <;<bDaĢ ?  <3 `Ȁ@] ,@K,`!<< !!̮<3-!<c</"$"(!l#<"bD<&"x-& ` <3 ?`(@x*@ٔ @` #ax Ȥ @ <a<"#4"@0<"-u@ 2 ` *@* <!?"&` ``@x <3<-Z"<3 `Ȑ * )&< b4   *,` ``$*!<"Вcѹ 2ѵҙ d-1 <3<3" "` <3 <b4<3 (??   (@ "*` 2 2``<"4*`@2`< <" 2 *<<@ #Г*`  * "W   < <" 2 *<<@ #Г*`  * "B  2 < <" 2 *<<@ #Г*`  * "-  <3" 㿘!!<3 <3`( @</<,  p<!" @x #@ <3 Ȁ @x  8  L@  V @  " ""  8  L @  V @  " "" <!<|!"!"`< d<Ē d" d"`<!<!"!"`"`<"<""""`"`<"<"""Ć"`"`㿘< *    **    ֪|֒@ * в@@w@w@M@@w@w<đ,   z@w#<3@w%</<</< <H, l@  (    (@l̠ c *@` @ @ +`*   Ԫp @ "p"`&pp`@wI" @wGH*o`0`܀ H`dj2 |В@* Ҳ@</!d*㿘<+#P<`  ;<3/<39<`| "@@ ?`Ȁ </"!lH*/ <2#L %<    , @ +  <! ?,  " , <#4 ?,  " $, <3 (  *??`Ȕ!*`"<"4!(`@@v@v<2cL <!<<bD  7<`Ȁg  ,@U, <"< !̪`<3-` <2L<</"`$"`(l"@< <2<#L``@ ,`@2`##bD&`@v{&`,` b ` <! # Ȣ`@  !"<4-`"@0<#h* 2  *@* !?"% `@vB` <3<*#Ҁ * +%< b4`   <3+, @"   $+!<#cC 2?# d* <3<3" "` < "2` *` <<cЕ* !# @" < "2` *` <<cЕ*  @" < "2` *` <<cЕ*  @"  <3" 㿘Ѐ</<*  <p!" @u#@  @0 @@" ""   @0   @" "̠ <R<R<#( <0(  8##("<!<h!"!"`< d< d" d"`<!<!"!"`"`<"<""""`"`<"<"""Ć"`"` <I  (*@$(2 06㿈<",  <ʐa<*` 2<`#ʃ<` <'"#< ʹa  < w <  "cb, "` @ *@㿈<Oa<`J<a  < ʀaӒ <  > <3 "`<)!8㾘<&  ʢb¡<bY @ 3` &xP <!< @ & P̔ '."@*`   <bP0 @` x&&`Ѐ " &`<"` )I&03`&Ѐ <")=& &А 1<&")1x<&`  8b`68< b { " <"Вn <&ϐ#͇  *&` /< `?2 * ` < , - `P@`$@@`   Ą $@ &` ܦ <bPɪ <  `&``  (!&` <&`А#H(ƒ`0 &`Ѐ `<"(`&` &` ڮ<#p (&`:   vD Ԡ&`$$ `$ 0 v7 $$$ `$ :  M  ^Ք !  v <3" `u$8< b{$y$ 6$ ^ސ6  76^<b$!@`   <<#ȦcR  ` ,   "`@"` Ȼ  uŐ Ԡ$$$ $ 0 u $$$ $ ȿ  ^a  !  u $`$@S,,DD,|||<*` H  <<" "     # " ` <H    "  㿘<",`*`<"L €@<8@<"<`` "`"<"<",<"<#Ĭ<<cܘ " <#cܒ`" " " 4" " " " " " " $" (" ," 0@" 8㿘<"P`D<<h < P<#<<;cд#* )""3 * @*`3 *3 @   #0#*@     ` #`  2 π0)b,? @0!<<#<c#< " 0 *` * @ 00 @(`" +؞" " 㿐<< <p&@2 <<2  <<, ""c'<$޺ /<< 0!<    "cȀ57<<<a<"b<"c)    $ 2 * @*` ` $ 2 * @*` `"`$ 00(`,ր$0 ݀7cē* В@*` % '% (( 0@  p ("2 * @*`@ `"  "`*@^< l;<c $2` *` Е*   h  "@ *` *  *  *  : *  <:$2` *` * #Ȑ  `'#Ȁ# <D 8$0<" !"` <" *$0} $0 $<=!ė-<*`#\# -.&<=ġ:` /$ 0!4!, <=ᄒ"""DDLLTTTT㿘<",` *`<! €@$@<",<P#p@E||H0h`,㿘&@2?&@@ <&?&@! ?¹㿘<܀ 2!< <"%"X!<", 2<<%"< 8<%"",`2<<%"<%"<<a#@< @` ```@<"̓*` €@``  ``Q`2 < @*<!p@ C<`ŵ"a`< @* <"@`0@<`š#M`#"@"@<#PŔ@`@<#Ŋ6`#"@ @ <#z& $@<   <!p* <#bf    "`8  `_<"*` €< ( <": `N#  ' 0p @@ 0~`? @ 2` @   0`? @ c 3# @ "` <  2# `  `" 2  #$    0p @ 2 .@` @ ?~ z    '  *:``?*@  n#` `     @# $ 0$ `# @L  2H#   8  ?442  ? $ < #($ # $ 2&#      **`  2#42 # * 0 #$ @# #$ `# 0p @@ " `< @ d @ n 0 @  " `< x R ? @K*@ 0p @@ " `<  ? ?92 0p @@ 0 @  " `<  ) `#?*   @ @2  0p @@ 2 `? 2 @@<` @@ ?` # @   ۔  <!   2#,#@* @<!x  <ސ!X XXXXXXXXXXXXXX XX X8XXXXXXXXXX 8LTLTTTTDTTTTTTTT㿘 < #<<%<<5<$7<(9<,<0 <IcЅ(  & &p&@ ı0  .  0 (cІ& 6 (. 7 @(& 6 .  (&@ 6` .`( ┆   @op; * ( )&  %"0 (&6 . ((@h(  @ 8<  #8@##@#( * <<< ; &00(`*o & &&0 ((@&  &?@"  * (* ;" 0 1<(& cб6 . ((@h( 8  @ ı0 . cЄ(@  @& & @`"& 8`& `& 8& 㿘n l3<K?"1?0$`\?   0$Ђ``?? <I? 0$Ђ`" <I"p6 ` * @ @@#@ +<K!``  2`@mj`@/<` ?* " 6  ` @$@@26 !g``  2`@mK`@6 ` ?* "  `" &0 ?㿘 ? <`<L( 2!<@/ L  L.` @(` 2 L(1?#?3< <$!&a#@U!Q L>?7o9?  @@ @@ L@ L`@ " &1?&@  @&@@ `@`ζ@<#@?@#@<  $!<Ip2  2`* ` <L J `*`J 2` 㿘< L.` ?# ?  )<3#@ɒ ! `L.``@ (<I@ * "@""%! ?<"a<",</?@< 'H"a "P<@"cܰ/9<K5<K;<HX(7<<oa<"cܰ/9<K5<K;<HX7<`x<cܖ <c( <c0 <"c<܀ 20<#@< 'Tˢ' <Ђ` ?* 0&H'<4#)`&p4` *@ @!  2`@k`@< ?* " 4  @  !  2`@kϒ`H Ӑ`-?5#)`&p4` *@ @!ʐ  2`@k`@< ?* " 4  @  !  2`@k`?  Ґ`#'?-?)`&p4` *@ @!픐  2`@ky`@< ?* " 4  @  !}  2`@kb` Ԑ` ?o p' ?`*? 6*1<<Ђ` `" ?<L!x<I!h* ? <<>!<;!hL`       ? << L-@  <!<!h`#@$~<$$A%@<`L-`!?@@$n%$@%1%@g< ?c.@%< <  @ ? @"    @ АE .@(X- <ᴀ i<!?@"@ -<67<#)`&p4` *@ @!칐  2`@j`@< ?* " 4  @  !좐  2`@j`?  Ґ`?&? @"   <@( <q"<n!hݒ .@X<L- `2 <`L  @ 0<!<N@ 2L8J!h-@`2N@`&p@<3"!"<3"a<"` "<⌒0 ""< ( (< 6 "("<I   #<   bX    <## @"? @ <J ?#"? 6"<I"`  "H<3 <I  -* @@ @ <#@* 3`*@ "@ @@ $ *` @ @@<J  @* 3`@*@ "@ @@ $ -* @`2…-<3<<ᔔ  ""`<a <I"<I"<I" <I`"< " "    2<Ib z<"<< "c\""<< "Вc ""<< "b""<< "`@""<< "b ""<< "a""<< @2 << "a8""<< "al""<p< p"pa""<< "`h""<$< $"$`""<<"@< "~b< {<"<< "c""<< "Вc""<< "c""<< "`h""<< "bD""<< "b(""<< @2 << "a""<< "a""<p< p"pb""<< "`""<$< $"$`""<<"@< "b"" <ܐ ꏓ*`<2 *` <ܔ <<""c<, @< @hf<cܠ < /@h\ 0< <ⴀ  <T c&0 <c2  ?!Т@@hC<ğ<@FH<b;c 2<J* @??"<<""2* @?" "<"b/0㿘<#<a@  +)</<-<91<<c <c( ,<c?% << <`0? << @ 0%@% *<3  ` 2Ơx`2<Ɛ hr 0%%% < ]Ѐ<  << `  *$Р ` $Ā#d#ƀ#d#㿘< <<"`8z"L< <  " c""<$< $"$`""<\< \"\a ""<< "at""<d< d"db""<< "c(""<< "ܒc""<< "`""<X< X"Xb""<< "b""<< "b0""<< "bh""<< "Ēa""<< "ax""<< "Ȗ@# # << "a""<< "c,""<l< l"la$""<p< p"pb""<< "cD""<< "aP""<< "cl""<< @ /"aāЀ$Ā#`#ƀ#`!?% $% <ĀɄ``2 #d $Ā#`#ƀ#`֠#㿘z< <  " `""<$< $"$`""<\< \"\a ""<< "at""<d< d"dc$""<< "cx""<< "ܒ`(""<< "a""<X< X"Xb,""<< "bH""<< "b""<< "b|""<< "b""<< "Ēa""<< "b$@""<`< `"`Ȕ""<!< !#!`d""<< "aP""<< "aā㿘< << "8M"L㿘< < "`8<4<`    <<4<` "L"4 "aL/㿘Ѐ#Р Ā0<<  8<H* <`4< <`4< "!L"`4<  L<!d<!d"!d"`"`<!<!"!"`"`<!<!"!"`"`< < " ܆"`"`<#<#"#"`"`< X< X" X"`"`<"<""""`"`< < " "`"`< < " "`"`< < " Ć"`"`<#<#"#"`"`< < " Ȇ"`"`<#<#"#``@""<!<!"!8"`"`<# <# "# "`"`<!p<!p"!p"`"`<3< <""!ĝ㿘! <?# &҂@ @ ` 2`&Ң#<<< " 8"aL<!d<!d"!dT"`"`<!<!"!"`"`<!<!"!"`"`< < " ܆"`"`< X< X" X"`"`<"<""""`"`< < " "`"`< < " "`"`< < " Ć\"`"`<#<#"#"`"`<#<#"#ad@""< < " Ȇl"`"`<<ȁ ƀ@(Ġ㿘<!(<< "8"L<d< d"da""<< "a""<< "a""<< "ܒa""<< "a""<X< X"Xa""<< "a""<< "b""<< "a""<< "Ė@# # << "a""<< "Ȓa""<<""aā㿘ր<3!`pp"??ĺ@Ђ@ 4 =Т@@ <3!$@`* ` "!$Ҁ *@Р 8` ƂE(ƢE * ֠<<d!x ` d"d# # <<" ` "# # <<ܐ" ` "# # <<#8 ` "# # <<Đ# ` "# # <<# ` "# # <<Ȑ  ` "# `# ĀO<8<<38 8"!` ƂE(ƢE<# <# "# $"`"`< $< $" $"`"`<!\<!\"!\ "`"`<"<"""t"`"`<!<!"!"`"`<#<#"#"`"`< < " Ȇ"`"`<3 <H<<3 " 8"a<#<#"#@"`"`<< Ȑ "`"`<!d<!d"!d"`"`<!<!"!"`"`<!<!"!"`"`< < " ܆"`"`<,$< X< X" X"`"`<"<""""`"`< < " d"`"`< < " # X< X" X"`"`<"<""""`"`< < " h"`"`< < " 0"`"`< < " Ć@"`"`<< 㠐 "`"`<<$ ĝ< <"L"`4ЀH2 2`2 2`   ` < ̓* €ĞPsH| 0P3`'.`+<as)<x%<'<+<# /( XД  apʔ   Hq ml` `  0 ` <W<Wp X#0c   " X<W<XT#0  T<X<XX"Ą#0  ""<Y<Yh,#0  ,<<T  #0  " #0  "#0  ""㿘<bb "b "<cc "c"<bĖbĐ "b?"<`` "` "<b8b8 "b8@"<a\a\ "a\?"<bb "b @"<b(b( "b("<`D`D "`D!"<bܖbܐ "bܔ "<`8`8 "`8 "<cdcd "cd "<`` "`"<`` "` "< &"c<< "b`$""<c< c"cl""<#$< #$##$b""<4< 4"4b""<< "b""<< "Ēb""< <  "  4#`#`<p< p"pb""<l< l"la|""<< "b""<< "Вb\""<< "b""<< "b@""<cc "c<# << "ⴒ`""<$< $"$`0# # << "̒`""<D< D"Da ""<\< \"\a ""<`< `"`a8""<< "aL""<T< T"Ta`""<b< b"bt""<"< "#"`""<L< L"L`|""<|< |"|`""<< "`""<`\`\ "`\?`# <P< P"Pa""<< "a""<< "a""<cT< cT"cT`<""<cd< cd"cd0""<`< `"`""<`x< `x"`x!""<bDbD "bD""<cXcX "cX""<b\b\ "b\""<`` "`""<t< t"t`H""<< "`""<alal "al "<`8`8 "`8"<`ܔ`ܐ "`ܘ "<bb "b"<bb "b"<cc "c"<<`$"ጐ`# # << "ᔒ`@# # <t< t"t᜚` "`"`<< "``""<< "`h""<< "ؒ`""<< "` ""<$< $"$`<""<< "a""<< "Вa ""<t< t"taP""<< "`""<p< p"pa""T%<<<xd x"x"`"`<a` `""`"`<#<` ""`"`<!<8!` `8"8"`"`<'<(X   ("(""<;<b """<9< ` `"""<`7<   `"`""<5< """<3<c   """</<` `"""d<  db## $<!bp" " `< $`ܒc  !< $!`l#`#`<",`X< $XbD& & b< 'bb%% < ' `%`%`< &`% % < &ĒaL!!c< &cax! ! < %Ȓc ` `", @",@", 轞ؒ ` <8 ےb0<<88   $@<"H<32 <2   @ , @*  $@& ( @  "@4@0@"$` @8@@ 2@$`  $`$`  $`$`  $` $`@?"@"``$`8 4 *`   ``` *2`j; 2$`<"h@]$``}!<<`$c̑2 `* #@]2   &$0 <3!`<3`ɐ&0 0!(` `&0 @]@]`@2 "`@<"&``"O<<`?<3 (<!\<!\"!\@"`"`<!<!"!"`"`<< "$"`"`<<"x" (" <3<!<!"!,"`"`<"<"""!<!"!@"`"`<"<""""`"`<"D<"D""Dl@"`"`<t<t t#t"`"`<<"|" " ؒ _s($($8 $h <$h $h$h$hc $h  <T P@P 2@<q#@&@$h"@`@*"@<!\<!\"!\@"`"`<< #"`"`<<" " " <b<b"b" " <bD<bD"bD" " <bt<bt"bt" " <c<c"c" "   @ `     뒢`!"@ Т Т Т Т Т Т Т Тꂠ` <!<Ò`<Ô@`" @ @<"<ÔX@`" @ @ 㿘<u!!㿘 㿘㿘㿘㿘<     YZ <K"`@㿘<3<(  㿘11<3 <3<H<9 ( </;<:9<9ذ'n2h#&@'#.?< 6 3<ƲbH` Pn2K9<!TaX 7<'؆&'aX.<ĆlHo`n21 aX'&'aX.`<ņHo`n2 ,aX'&'aX.`202020ʀ20㿘<    X < "a< <K H |"? 6"㿘<!!  X < "c< !@<:` 㿐?А <" "/'6  i" - /p , <- b Z 2 <<"(`"(7'<Mb0  O<"8`"87'O /<N А 8  _ X. @ ` ` " 2`<:` ` N ` X<:,`"` $ $ <<( 8<: 㿘@ @ %<`h ,`@@ 㿘<:<D"/c㿘< 8#(  W < "c< ;#8< t#h  WӚ < "a< ,#x㿘6 .  '<#<%< *@* 1.2 2 $㠀 $a<a2 "a fڒ $?.a *@*< 42  2<  ؓ*``㿘%<= 0!,<_`#!"̢̔ "?$"0$ <<cȠ$4 $D$@<= "`x㿘< #  W[ <="a| ) <=<= `|'<=@  WJ ` $ 2   @" 2 $   "`2@0< #<<Ȁ  <=<=   ᐝ㿘<  : "  $  "?< 㿘<&@2`  8!2` *` <=,! @ "`* #!"` !<<&d$# #А!$`@ $`<_ ؒ *` * 0 `,8@  &@2 2`  ?$`$@$`A ``*`㿘< `!  V <_ "bx< !㿘6  +<A)<A#<A'<_%<A  *@* *2 2 ?%c|  %#<A2  `" e $c?*<"2  c < ɐ"@. <"h H  V_ $|< "x!<AԐ $#Ԁ  <A|Z5  <A"#$8<a< 2 )<. +<O-<<#x4< "@<{!l!$!$4 $ $!0a( +@ $ ,$ `, @ "@h"  ,"h "h<"  a0 4<<!`<   0 \ 4 < 2<< !p"4<<2  U<a"`2<@ v!{W `$<4`*'!l   7|R? !l  %!l7|G:  <<c<" 0"0$ <Ec13<Ec1/<F` 1+<F`P1'<F`1#<F`1<Fa1<Fa`1<Fa1<Fa1<Fb,1 <Fbp1<Fb1<Fb0<Fc<0<E`p0<Fc0<3a  !<F#0<3a * $ @@<#X4 <"aL㿘!<G <G`0Ӑ<Ga<0ϐ<Ga0ː<Ga0ǐ<Gb0Ð<GbL0<Gb0<Gb0<Gc0<Gc\0<Gc0<G0c㿘<!`4a < 4Z!h<d"aH< 4S!x<d"aL<  4L!< b" 0< !4D < `d" 0㿘<Ig"㿘  ?А (  $ L .$ L :  :, 1<$"c㿘ڒ , B< *?`h :<$ ˒ = <$,"H @ &  2`@  Ք `"@<$" "  2    (    $(  h ̐N  <`p B/.o-<$!<`x`x <$  ?#"@% <?$ H? '/ "   <$$ ($ 4#$ <$ D$ 8$ @<."DA/<   <  ?㿘<$#< ? "`!<$1.   < ͐ ?㿘<# ?  ?㿘< 2a   *`" * `2`""  <ٖ4c<<_"8bL<""# <?b0'h?D <#$'<$D$ D?*`@  E *` "`*`  <^ &"`c$? "`#XnÐ ?G$D  㜒#X"n ?<}#|+<~)<`'<`-<a;<`   4a@    ?& $%"`$d 4?`<#$c )<?$D#D. !*@ "`  *?Dc$* *   "? >? D* * " D *`*` "  2%xD(%%x? > $$D$D낐G/bx<^`0" $b<"@<b@<`"#`H`</ Pj2 <:Th"T*<`"l`"Gt" Ȓ#Xn x2 0ߝ㿘<<acpm  <#U /?!<a"<* a<"<<<<2 #8`x "$  "@"@"@"@`"<㤄8<ؒc8"`x<ِ#4"` " <#'  㿘"L  ??"`  . <   ` <>`` " `2   2< 0W  \#m@2`   Y#-@2 ` < ` cD2`  ,`  ;    ,` : ` >`" @@2  8<   *@#@<<  ?# ? ** @2@ 2@  ` <   <>`LȐ |/0'L /! - \/1/2/3xb `h_!\ p h7''7R `O!8L p ؒx87( 7' '@mK  Р  mC ɑ. <',!<2 %  L@N  $<#* 2 @ <!0/$KȒ  2<<$!`5 #4* ` * @ ,  ", 2  < !y<!˒@  < !<"@i<" @T<;<9<7<5<퀤`/6  2*ېb5 q6  $ € ʐ"yl Ȕ  ? X $$`$0`2 ` `0 `*`p:``@`<"xK5 p L!<2!< $€,!<㿘<a"`!<!<2  <b2  <a"` <aE<l"yq<a!<⌁㿘ܐ 㿘א 㿘! ˔ 㿘J 㿘K㿘<a#`?<a1< `  <a "c <a "c ?㿘<a!<a %<`#<b `##  <a<! 4 *  @  $` #㿘< @<a "c㿘<b?<<a<a<a<a<a<""a"###c  # J| 3< &`<א H? Jp !<  $ LSLzK(`K& 0< x`K?㿐5<(1<  <ޢ <`!````` < &!!($  <a4 ! <<%<'<)<'+<%-<&/<&␞┤┨!$c< $ 4  $ $ <'4 $ ,$ 0$ D$ P$ T$ X$ `$ d$ h4 $ L$ 4$ 8$ <$ @$ t4 $ $ $ ($ \<&<&<'$ "`x$ x$ $  '<<`0`  `<` <`<`<`a@`b!1"└  !$!1!! !(!,!0!4!8!<bi < "X ?㿐<b! ' '' <<b"!<| N<ސ`   )< '<`%<$ ( 9< < #< <>'"| <><=cഄ0b4 "⤤`  ?  <=$ 4 4 $ `$ d$ h4 $ $ $ $$ ,$ 0$ 4$ 8$ <$ @$ D$ P$ T$ X$ <=$ t"<><=<x<=<=<=<=`̘# c$ l$ p$ x$ |$ $ $ $  "<b<͐#!4<<@ ""`` #"<9<3H!@ #""H)<<b<b!a!1<b+<3</5<: * $a b"S`"  ` ?"` ` @   <` d <b b<ޠ!`    *  @`*@  * ` `''! <b"!L R&!< <`!@ ! ,UR0 V9 !<S <! `""<< 0 8!*@ ``w <b"!$<q @<bX"H<;cLH``Pk2 <TX <" !ؖ" &X+2 0㿐? 8?ϐ c '//<ސ ( ?)'c@1</!<:#<: >*@*`*`*`?`<ސ"| P<@#"b<K`H` Pj@2) @<T!X 0<" !ؘ" $!X*@H`j@2 @aT$aT*@ 2 @0Ҁ2 @0㿘<ܒ$Đ#<c`se !<ޠ  $ < a %"$b; $$ $ G$ @h㿘!<"В <a` $"а ` & & & 6 6 6 6 6  !<<d!p# <a` $ 4 $ 4 4 4  !<<M! H ɐ<aА`$   4 $ 4 4 v4  !<<5!! <b`$ 4 4 4 a$  <!">E =@K㿘<<c`Xg  < G @  @'@(㿘b< , 8"? 6"< h#"? 6"< #<  !<    @$ <" d<<"`h" l㿘<<cb`$g:  <"h 㿘<ޢ! Q  , @ a  >㿘@   " `@@ " ` 2 `@@ &` `@ 逤 ?㿘  <%L a֐ =<%`А 7<%a ʐ 1<%`Đ +<%a %<%` <%` <%` <%`  ?# <%<%` <%  `쀢  ?㿘<<# aH<<<<X㨚b(x/T  & & # & T& & 6 Z. o6 X& & 6 P& $&  \E  & \?/ \<`p& @ 㿐     E֒  & \? <m!` <ma  "a<m!t<"#<#< h`0#&  %<+<mL    : ,@    $L<#``3`4 ax `0  \  ?& \`$`00<40 |  $`4` $` <m!|0"$`$` 4`` <c͔ ax4`$`$@$`|$`!<` #В $`   `  $` <c O 2S<<#<.a<ɒ` B<  ; v <ߒ`0 -< 8<} pӠ<", "< <0 <0<# @ *@0 #  *0  $` $``؀  $`$`$`$``| `"y.`|` ?"` 2<<<<!<$`#H!cXH& & & & @& `& y. =$`$`$`$` <  㿘<m  Q < h G"-<`"?+<)<􀤠2 `Ta  $ J! < l `2   1 2 @`  2@`ɀ2  㾰<m '  < h '$ "$  $<`  2w "s<  2k  "f  2` @ "Z ܒ 2T @ "M ϒ 2G D  ' \' '<m<"`   L  `h*@   Lᔐ  "<m!<Q!'''    $  \`" <`L   `h*@  `L@" `` Cƒ  <&ؚ   "  " "`( ` ?Ȑ ,`"  " ? ,` @"" ? ,` "  ?"   ,` <@Ȑ"   "    "` a( ;  2R< `0 0 '4'Ț(,``   , . @*` 0* @ 2  @* 0<'@@+ @ * 0" @`4@ @  "@ ` ' `0`  <b8 4  0  &<\"P <  <Q"   $ Ȱ?   w/ ? <<" ? 2 !<" 1   +  `  @  0 0   &`  "@" "` D5<2 "  D 2`"  3<" /<-4+<  0 84 "@` < @ c "`   h$ "` cx$ $  "`    . ?   v ?2 <"P`$ Ƞ?   v ?2`<"``<"D-<+<'<%<3<5<  d" `H"`" "`@"  "*`=  a @ <q#- <  /<+<,`c`   h  : X  $R``$,` <#0<"E    "  \ BB   <$y'$   ( <ma  "a<m!<!@< !<b$` `h%<L    : .   $L<"`\&(`&(`2`` " ``<"<"X 2H(` X<b O (` @63`d  (.``0  0 @2* (+ ` `0"@(`4  "(`@ք (` `˒`0(` `Œ`0(<`0`4  # &<" @<  <v#  &@ Ƞ? @  uT ? <a!(?  (!<` #HU (   M ` 2@ "  0 0"   &(8(<`0X`4 4 Ϛ & <-#pl (<`<`@#`  & <#[ (<`H`L   & <  J <`@'(& & `  <`X<b,  &(00<!B`h&((&(,&((", <<&(X&(D&(H&(\&(Đ#@c$`$`<"H< $`<< `8$`@$`( $`,`=0'@* 0<" "  "    "  4  " #`  A$`\ 㿘<m  5 3< h `)"` ""@)<'<2  ݒ x 2  " Ӓ 2 W ۤ 怤@`2`  㿘@ <]!0`  ?<m"!ԁ㿘@ <L"00`<n""㿘<m!ܚ!<<I`|<I "!<#` !@"@<aH 0  @<`(H`</ Pj2 <<:X (<T" ؘ$" X*<n#`'<n    `t"@`€@` <!P㴀 "<%<#<!< `"  h`ax"8 2 <Ր!㴀 "# `"   "@ 2 #`)` ""@%<㴀 "  $ $`"@ 2 $ $ " J P(2 2@`2`㴀   `"   "@ 2  %`@ 2 0^㿘<n } <n<]b8" +<n)<n-< `"c `2  H/`l2`  @. `,  @. `  " ``c@2 "䀢`' "&!%"ð d<n# c#< $ `" @ 2 2a $``2  "} 2 $c<`!<!<" 9<nZ#<oW  2 0㿘"\ `<#  $`<`x2<<#@!& \&  & < `9< 2"$<`9<&` cXՖ @& X l : 6  2 2,  l (9<3< "   2XX@2#` ch   2    2  2  \<#p  < \#w?!0 $ &  `&   ` `0 <`0`4 <`<`@  & <#<cr  & x& t<   < "P  `4" T   `;* X ",` &"/" \!<#<3<-<+<!"4"D""@"  <\<c̖( @{ " <А 8<`\ X \# X <\<`( @{~ " < 8!< \ h@;J`\!<#<3<-<+<!"4"D X x??&"< X`ٔ?&""?2    < `˔ &" &"  "`# d"* X&" &" <︐ ` X?    ? #@@ #? @ LK!  ` &!`2&! &!#&!沒* "@*`@&!*`#&!Ē#* @*`@*`"@/`  2&!Вb@&!̔"\в` XV   N  ` 2 @    "  `@  ` 2  0 0"" "   &"$. `. a/ , , ? <$!.&". a/ ,/ 0 . b. / 0 0`<!  &" q b*? 6*. `/ 0 <<!8 &". a/ , &!!P &". a/ ,&",&"0&"(."Z&!&!*? 6*."  **@  $*? & . ."U."T."W."V. . 9 㿘< h<"a̮  Z  7< `H<"5<`   .<!h &x 2`  &h <c` 2@`  2@ `@`` 2 <!n<o"ad㿈<o<% a"xl w-`2   /,    , " xt$< #4` 4`"4`B`  !p* ? `   xZ$< #H- 04d@p# 4`%  4`0   4`0 4`04`4` d  .%##".%4d. 4d@4d@bv! .%.% 4d@ 7 77777   < $m#p-`  +< ,  777 ܔ  2$@ $Rc4&, 4d@o# 4`4`  4d@ 77   2$" $< 2#77   7   2$耤@$<   4%.$* .$: .$77   2$耢" %$<  @~ w02  <$ 77 7 n<# 777 d w X<`h<o"<'`   "b4 ` "q@< #8 < ah < ap < a 2W < !-M%䦒 x< !2 < "$<4$$$  #< < 4+<  2"&4#< < 4+< $  @b aO$@ *- $` `0 b 0 4 }8 $< Ꞑ"@@`4< `0 h  j  $< ꋐ",$T$P `;,X`$$\4*@ $"@"$<",`\<#<!P < Ⱄ @x "< 쓐"  $#< `\@7셐b< c??$< cw?$?2 <  c k $< #("dd_    W ` 2 @ "  0 0<  < cHB, Вb@ * `, (,$< cXT$$< cpN$ $ < #   < ڐ#  " < Ґ#< # < ` * @  &`4 &aX&aT`@ aX *  "`  `4  &a <"H`e<Ɛ"і @?" <"R`  : &aP!Tb x?" <":` <#@3`  : &a#&`<",` `, , " a , 0  `, @wk, & a , 㿘"&`6?&@$ $'  !\6/$ "`  0$ .  ې!\㿘<a <",  <ch C - #<#pk <<c " < <zc & < ##hp 2 <ic   _    <#p35!p<"`h$$  ,   <"@3<,   <2<)<#<c?2<_^ @<#Вb@i#eI#耢 #^B## ِ< a. ,` $ <c$h<`$l@"ȐK 5V!\$$5$>  5H!\$" 5(1#`$ `56!\$$$   5'!\$ "   ڔ0$ ' ߒ @,   <c ",<c  ch  !p4 $$B$ , @,`7㿘<:! && & < @@ "(  `<@" 6 (@"  $@"' + ,@" % & $!)<<& $ !#<<& $!(<<& $!8<<& $!H<<& $!` <<@!x<  & <!㿘 X+<p<a2   )<!<(! <a! <a 26 4[ (< l` $ @@ 2@"@" l   `0۔    `0Ԕ  !0 4 3 $ b4`  $ P%b4㿐? 8?ϐ c '//<ސ ( ?)'c@1<!</#<:%<: >*@*`*`*`?`<ސ"| P<<",L<<c"b"#<a<bP<bXM?? ."."<`ЇH` Pj@2 @<TaX 0<" !ؘ" $aX*@H`j@2 @T$T*@ 㿘<p "#<ʐ"!< <,   *`@  ! gސ d `!@<"0P  < ܐ"+</<-<q 1< +</<-<q # g d ` "Ȁ   彐 "-b bȀ  @ <尐"@ <婐"@ € @ €  S͐ <唐#2 @0S2 @0l㿘<! `<偐#<v& & 8 \  E. . & & &  ?<`?㿘<<#ec㿘<v x@㿘< 'D`D@@ q " D@ <D NP ''  <v <<#b, (  < <@<< <v .  "  <" "  <㰒    ') <a,`)   9<7<  <cЦ >   < c  `<#♓> <` 9<7<[` +<<∐ <" ^"`%<-<3< (0?L, `8 "$<@ ex<`n 0?2<  c  $ '< . " <`P "<v@`8Ԗ 6x `耢  <-  `<"  < 㿘!<", %<v;<-<7<3<)</<+<5<19<<a$",` ʐ  <ccЀ  $ܐ "<Uc <L` "  $ ` * * @ @* * @ @**` " @* @ @ @ %b&&`p% %%&'`|Ր@` $)"<)<<v tP<&L"`"`<)Ր<v<<#<< "L< "`"`"`"` "`㿀<cH`</ Pj2 <<:XT <" ؘ " X*<<bؐ!("`/<"`5Ѡ0 }<<<v`< <    < <  a %0b<($ $   @  , 4 4 4 4 4 $ ,$ 0$ 4$ 8$ $$ @$ D$ $ $ ($ <$ P$ T<&<$$ Xa<<!<!<!<"<"<##<"%<"'<$)<+<-<%!t Xc$<`,#pcȬ$ `$ d $ h$ p$ t$ x$ $ |$ $ $ $ $ $ $ $ Hr <a( 5%5j# <!0j <ܐ!Xm"5<lo'<v` v7<mlf<<v `p* ?<"   a"`p"@a(<vࠐ p*  Q"/<+<  |,`,| `""@ p"@*` p*!`,,p*@ *`(p "` * p@ *` p( * p(@ *``p*@ *`(p"` * p@ *` p * p * <v "lĐ<<`n <v<Q!࠮ * <-<    1<-p@,`  ,db ,d^ d\ p @`,dU dR p *"p *bp<  # t ,d@ F,d= p b  P,d6 ,d2 p b   ,d* `,d& p b  ,d,d p b  ,d,d p b   ,d ,d p$" " p b*א p b ?,c ,c p "  ,c<`,c p b ,c,cܐ p b ,c,cӐ p b ,c,cʐ p b  ,c,c p b  ,c,c p b ,c,c p b ,c,c p b  ,c,c p b ,c ,c p"  0 *@cp"  /cp  `/c{p  `/ct 'ɑ-p *#p *cp< #  ,c` F,c] p c ,cV,cS p c ,cL `,cH p c P,cA ,c= p c ,c6,c3 p c ,c,,c) p# " p 'c  * p c?,c  ,c p #,c <`,c p c ,b ,b p c,b,b p c,b,b p c ,b `,bܐ p c ,b,bҐ p c,b,bɐ p c,b,b p c ,b,b p c,b ,b %E<v p* @J` "J` `y p @`*r ?<v  p<` - `-   p'b d`c   ,@bx @bu  ,@bo ,@bl ,@bi  0,@be  `,ba  ` ,b\ ` ,bWjtiL   ,@bL ,@bH 0,@bD @,@b@ b>   ,@b9 ,@b6    ,@b0,@b-   ,@ b' ,@b$    ,@b,@b   ,@b ,@b   ,@b ,@b    ,@b ,@b   ,@a ,@a    ,@a,@a   ,@a,@a     ,@a,@a   ,@a,@aؐ   ,@aӐ ,@aА   ,@aː ,@aȐ ,@aŐ ,@a  ,@a 0,@a   ,@a ,@a   ,@a,@a i p@,   0 *@ap   /ap @` /ap @` /a<v  *` p<v  `, @*`- O- ?: - - ` 'ag d   ,@a_ @a\  ,@aV ,@aS ,@aP  0,@aL  `,aH  ` ,aC ` ,a>i[hM`   ,@a3 ,@a/ 0,@a+ @,@a' a%   ,@a  ,@a    ,@a,@a   ,@ a ,@a     ,@a,@a   ,@` ,@`   ,@` ,@`   ,@`  ,@`  ,@` ,@`    ,@`,@`ؐ   ,@`,@`А     ,@`,@`Ɛ   ,@`,@`   ,@` ,@`   ,@` ,@`  ,@` ,@` ,@` 0,@`   ,@` ,@`   ,@` ,@`hǐ<v*` p @` F ,`,`|  p @`,`t ,`p  p @` ,`h `,`d  p @` P,`\ ,`X  p @` ',`O,`L  p @` ,`D,`A  p! @! `$`, ` ?,`0  ,`,  p  ,`% <`,`!  p @`,` ,`  p @`,`,`   p @`,` ,`  p @` ,_ `,_  p @` ,_,_  p @`,_ ,_ߐ  p @`,_,_Ր  p @`,_,_ː <v`* X<`V #<<`!<<a0!+<<਒ 2` +$`X$``4`d$`p$`8$`,$`4$`D$`\$`h$`t$`x$`$`$`$`$` $`$$`($`,$`0$`4$`8$`<$`$` $`$$`($`,$`0$`4$`8$`<$`$`@($a݆a<݃!@` g < jb㿈%<| ` #<0 | `"""`<. p. + @ "`< *`(p  * p   * +`p@ *`  !"<v* ` `  p  -` -` -`-`  _" d`c4   ._ _   ._ ._  ._   0._  /_   /^  /^gfbL   .^  .^ 0.^  @.^ ^ߐ  ` .^ڐ .^א  `  .^ѐ .^ΐ  `  .^Ȑ .^Ő  `  .^ .^  `  .^ .^  `  .^ .^  `  .^ .^  `  .^ .^  `  .^ .^  ` .^.^  `   .^.^  ` .^|.^y  ` .^t.^q  ` .^l .^i  .^e .^a .^^  0 .^Y ` .^T .^Q  `  .^L.^I f*^C   /^=  /^7  /^1㿈V "<*`p * `p <!5-`!\ $`   *& $ <v ؓ* %` $ 0 "<v <v<v<v *`*` ฐ H*` *` ?ฐ (*` A*` -`   h*` *` -`#<v`  * $a" $  * $"2 $  * $ @   * `, ?`: - - ` `  ] d`c4   .]]   .] .]  .]  0.]  /]   /]  /]edM`   .]~  .]z 0.]v  @.]r ]p   .]k .]h    .]b .]_    .]Y .]V   .]P .]M   .]H .]E   .]@ .]=   .]8 .]5   .]0 .]-    .]' .]$   .].]     .].]   .] .]    .].]   .\ .\  .\ .\ .\  0 .\  .\ .\   .\.\ڐ e`*\Ԑ `  /\`  /\`  /\° 㿘c   < <v!$۱2 "2 0 㿐<)c8H`</ Pj2" <<:XT <" ؘ " X*< t" !<" s s*<v!`%<<'ډ"8 k<`` !<    < < )< '<$Ȑ @1#<!<<4<1<-!4!@b @Ģ`Ԡ P㴞<   ,#!!11!! !$!D!P!T!X!`!d!h1!(!,!0!8-<,1<-<.<.<.<0</</<.<1!<'#<'%<2'<0)<2+<4!la!,⸘!``d\㤞8!آb"cp!p!t!x!!|!!!!!!!!!!଒ 'S<bȐ  5%5%%Ha <"'` <׷"<p<vbh D /<)-< 2+4D4F$$ $$@ $ $ $$ ($ ,$ 0$  4$ 8$ <$$ $$$($,$0$4$8$<$$$$$$$$$$$$$$:$ ,@$ *@ *` ٚ`` < D `  ``  2`<b2 <v"bH2 㿘< r" !<" r rؐ*<v!`<k"8<p<v"ahD )<'<- &  & & ((& :n  , @$  *@ *`@ F#8.ѐ `/xְ!  㿘  O`M< D %<`y  <<b۔ <bԔ  <ch͐ " *`   * `@ 2&    @2 &   " "("$  & yyy <?a 'l'p'h'dyd'`<ycp t<cxy *@z\ 'd<bȔy $,zO'`yB`~h?Dl?A`<dD  "H<" "("@`0"$"D<- <v"|<`<v<t<t<t! <v``%<#<<< <  cĆ㸞L!<u" " " " " !<s<t<t#\#`#d``ht! h?<l?<`#?p  <uc<qc( ?㿘 !  n`#< rȔ @В ``  `@?А (`N@ `N@ 2? !6,4%`1,4!,+",%" , 8#,!p" , , ,,,,2`0` O"b e E" a V " o2V "baV "`D*` *  p" {& $`pa3  b"   *   *`  *  `*@ 3` *  *` $ X   $ $ ?㿘: < `< D `  (  <vbL ~2`"<v "bx 2 0<3<v ` @ c?<v(㿘?   U1<I p   1<?  ݒ  ڒ  1<  - ̒  1<$ ؐ ’ `  e   1<     1<   1<!㿘<v"`+<L  `(  r #<v $b<w_!80~!<v -<7<$"bXbw @ <!h0m<b!W<8<3 -<"%/<p2ᰀ 2`"-<+<`p% )<paX "`P@``2<ֵ!03`P!<v` #<v$b<7 b!X$"b( @  !<@!!֝0b#<@!b֓<8`<c@!"@! <" ւ㿘:^:<<vc ` ! ! @㿘<v"`<v"<v "c<b"P<w<v"<F"`<3 ,< "$+< oa 2 `")<'<`o"p ox "`P@`2`  2<*"<w`P!<v $#’  <㼔u `<" !< #(<`" < "? }(<8< b㼖xa @  + !<@!O"<w !<@!E#<#  !<v <v<w*##)E P<vĉ BHo`</ Pl@2; @%<:X!<!ؐ* 0$X N,@`^㼐 *`. , * d( & $ 9a㼐 *`9\㼐 `*`9W㼐 e*@9RHo`l@2 @ ,X$X,@`  (ѐ d?㿘<w(ʐ d?)<x<!'DcPv)    <K#X<<c  <v"bua<vgc < aXv `, vĐ v< bxu  , v g<!ucvB<cu  <ǒc  uv/ K7<uv' <+<5<uvu~va (/<-<uuvḀv aXvpu"xDuvua uou uh<u <D`?D<`hD<a<v<J<J<J<E<E @㌘#bb" " " " "  @2 @02 @0ڐ@㿘<w 'ސ <p 0^x!<]Ţ<ta<`u$! $! ^!    <X ( ?㿘<w'! < H!(`<b!<<*` *  *  ` `` ` 4`````?  4  ` `   `  ݀`<7<7<7!Шb<?<?<? ` 31<w!P$ 4 @  &!P'`#<w aP @(*`@2 @ *2 @*`@2 ``<b0aP`a< Մ$ <8  p<? <>!p'``0 ("<3 € <3  *` c* `X  '` `,9`87䀥:`x x  `** * "    + 2@*?O  OܐF `X @'<? :`x x{  2  *@*@*@   + 2@*?   *@*@*@  + 2@*?'۠  Oѐ `` `$        < ///////// `0 / `<`  `,` `8?`$@  x<7!<7<7b# '''ĐwĖȆ ̄    2@*@?   @ 2@*@?@ @ 2@*@@ `  "    + 2@*?O̠  O$'̶ `  w  O *  O -<3` 8* `Ҁ  ` 2  . * @w``: @  *  O.  <3 *` * Ԑ" * @6`@?@*```0 ( €  au O㿘<"  <`"!<Q!4"`0<w@P  <"  <B!L  <!, @@ L, <B!@  @ "  ` 㿘'DJ <JbHbHJK @ ` JK @ ` }   DD` 'DJ`  DlO D!<w$"J@kK2D* `$"'DDJ@ ,Ր`'DD<JJbXbX JK   JK   K J" <'DJ`  <DJ@ " J@ А``א ?"@*  >D0"`!@*` " <D*``" %L @0JK  JK   JK "@ $<BDD`'DJ` #<w k˔ ?$bb &$bDJ@` - 'D k ?<w"c<w"#<BaL I )<B<!!@  /<yq. D| 2" DJ@ :2 @ jgh !@@aL"@*  &@ %aLD€ 0ՠ <B!@   @ `2xL`  p<<aqk<rcФ< cq (? kR ?*`2`!<x`4 ( P4 ( (?4 (<c(q (? k: ?*`2`!<x`4 * "4 * *?4 *<<"8 q 㿘<$8  '<B<B!PbP     @ 22` $ !< , 2` !<Ӑ㿘<ba <w#؀@<x ,  >: 0  ,@<b!<<ޒa*@ ̝㿐'<8NL8@ ` N L@ ` N L@ ` {  <<|<|" "`J H HN   N J@ ` N J@ ` {   < j~ vJ@ x2sN` js kJ  2fN<|<|" `"`J X XN !  N J@ ` N J@ ` N J@ ` JN " <N  <B  &J   2 u<Bc#*@J ` `N   N J@ ` N J@ ` {D  2N<C" N   ,2 N ,8 㿘'    <oȐ h0,<b0 <b"L"b0wC'$"Ȩ  Ȧ!h","$"Ā$"0$'`$"? w 'H<`$'HpE $<`p?#<`%p8$% L  % tN< ` : p#tB<|/ 0`%<| 6!$'4<| `  `2 ``2`@@`@  '4  $'4 $'8'4 '8**&$  `: :` $'4$'8$`$` '4#* &$@'8 *`$ ?$`$`X$`d$`\$`$$`$`$`<$`0% ,<|%  % % !@$ 0?#<B4 ($ DgԐ<a!8<a<a "$ x$ |$ 4# `$ t$ , 4# "  #G $" < ԓ/  €@~@@ @7 @M@CQ"|$'h`<C <^c$" ($',<3a'$'" ',<^Ⱄ $' $'($'$"|<b<]`Ĕ ,"$"$"|$'d$"t  $ $ $ ,$'x` 4В?WUM 6 )0< 2`=p <na<o]a "<n<oU`   < h 9<7<5<3<1</<-<LJ@  ,2`J@ ,"`g[ Ȁ gVЀ * gO gJ`耢  gC  g<  g5 2<  g-a ? ?< a n ( 0OРJ@  ,2`J@ ,"`g  Ȁ gЀ * g f`耢  f  f  f <  fޒa ? ?2HLJ@  ,2`J@ ,"`fƒ Ȁ "3 fЀ 2+ f "& f`耢 2 f 2 f 2 f <  fa ? kj  2 㿐"< 4 %  5  %  !h6  К & 8& ,%!( "  4!  <'`@ h $ '8r ,'4  @$ '`@ < h %"'`<   h}@%"'` < * hs@%"'`<(   hi@'` <8   @h^%"%"<C %<e %"| #<d%" <e%" <d%" <e%" <d%" <c%" <e%" <|%" $<e<e"`a%'bl㠄Tc4 ᘔt%'|%"%'%'t%'h%'p%'l%'%'%'x%'X%'\$?$ @$$ $$ $$ "f"<"X<"H<"P2`    @8<< "` "h @8<<"x""1<C( @'`3 #\#`<b h]T㿘" "а!h 4`M"'`< h  g̐$"<"m4cx =<"  `  `p  <$# <#P <C<C&@% $"$" <C Ȑ @ `<C<C   !r lV `i"Ж* 2 <##$ 4 # $@ 4` Б2 $`,$`8 6!  6 <'`㨐 gl & `,p'8'4<w : @& <$"|<f$"<f$" <f$"`$" $"H$"$" $"$$"$` ,"$'x$'|$'`!Ђ * ` 0$Ђ` ?* <|!1<C!(<$'\$'X'`ch"h"< 4  !h" er`x"Ь@ =<<'`@  g  0&""Ġ<`/Дlt (OЀ $̐e J@ x<` eՒ J`-<2$ <$$?<  >  $  $ $8$,  5!  <'`@ࠒ f % ,p?'8'4<w  @% <f&"|<f&"<f&" <f&"<|&"(&"&"b`&" <C&"$"Ė<  a&"&'&'t&'x&'|&'X&'\x< '`g|<"k` 25 "  `2 < p`@``    k' g<C!ē*` <C"Ж* 2  !Ѐ  ! "* "Ж*` 2 㿐"< 4 "Ģ!h"ka  <& . &  , <&6 & 4  В $ ,$ 8`  4a <'` f $`'8o ,'4<` @$`" '` e "&"`<'`Ȓ *e "&"`<'`В  e &""<`d*'` eޚ &"ܒ <f$ #&' #<|<| "`P "`"`8"`D<w<h&"|<g&"h&" ``&"<&"a&"&"&" &"$"&"&'k&'t  <g<g<g"aP&'h&'p&'l<h<g<g<h<|!,c "&'&'&'x&'| &'\ !<C   $"*@ *` 4 #  "Вb&'X""?"`"@"""`""""`"<"!"Ѐ" "Ԅ" @@2 '`2 <"<"(#\ fL]S" <,Ă (  0Ā`( <, 0Ā`8?p"'ܢ<"Ĥ !hbjU  < "䀤<#o 0&'\ "&'`&"&"&"$"<c(j(  @ `?   &'X  <C<!<w#<h/<h3<i5<h7<h9<i;<i+` @ *`` 'X"  'X  *" "` * `'X`@  " 'X@ `#*"` `* `@Ϛ`00> 6   . 0$$4 ,  $8$,4 ,n'8'4#ฐ @$# &"|b&",&" `H&"&"&"!x&"`&" <i&"a$ &"܀ "` &'L&'&'t&'h&'p&'l&'&'&' &" &"]<#@<C'`#   "Ж  3` #\e>㿘" $_Ր #``  "?  @ ? $  $ `  $ $  "؀` "Ԅ "? B""" 0 ?"? B"P" "  < 4 $  $ "8"," Ȓ    " ," 8" `" h⤐ ,ݒ  20 < T#@ #`#` #` #`#`#`#` #` $#`(#`$$0  4!  <`( c $ 84*  * @ $ `<0  c`<$Ԗ@  c`P<$ؖP  c$`<`  c~$`<p   ct$<C#`h$|#` "$ X$  0$ '`$ 't$ '\$ 'h$ 'l$ $$``*  $'l't'l't 'h'l'tܖ?? "$.c$.$.?$.$.  B$. P$.$. ` `?*`  & &  & &  <lc<l<|P"1<C%<m#<k!<l<l<l<l<m<j$|#Hch"ࠆᜄ<`t!$x$X<`$$t$h$p$l$$$爒`$\c5\6660605\㿘<CJc  1<}E h<!`=!<}<  *` €<#<}` h`"  <}J   f *J  * *`  `*`@ 2J *<#!<}` h`  .# h7$7l747@7l7l7l7l7l7l7l7l7l7l7l7l7l7l7l7l7l7l7l7l7l7l7l7l7l7l7l7l7l7l7l7l7l7l7l7l7L7l7X㿘 <`*"#< "D*` €<"!<  < < < "a  <#<g  c#< #< 1< $a"&!gI  <񀢠"ac! ?c?  #<<#! #a@[@g#<!wa9;H;H===㿘 @B  / .`((@  `@(@) (@@ ??& & @?@(@  / (@ò 㿘<!3<`5<}9<}7<}< X*` €<#؄` )<+<񀢠-<3<5<}9<}7<}#   """ ` ?*`ؐ * # "@ <!   """ ` ?*` ؑ* a "@ <   """ ` ?* @*` # R$ Pa Nh<afD <fߒa8!<<!, a@f|#j$  )<+<-<3<5<}9<}7<} `  "` ""   ?*` *  "@,<aP#fSi  <# `  "` ""   ?* @!*`# e$ <faX,@f.#i֒   <! ` "` ""   ?*` * a $@ѐ  `  "@""  ?* a *@ 8" #  ha &a !lp" " 㿘<<a e"l<f;bH  <<bP,eٖ!@?!li~ $!l!l`<eY"XX!<", #&ad<"P`$` e!@?"",ib &ad", e!@? iS adbfinddevice/chosengetpropstdoutwrite On sun4u you have to use UltraLinux (64bit) kernel and not a 32bit sun4[cdem] version exit>>?? >??\?| 0@P`pxph`XPH@ X@@ZZDZtZpZ`bX PPl@06$(1N٘(Y+@CxCxBoot time fixup v1.6. 4/Mar/98 Jakub Jelinek (jj@ultra.linux.cz). Patching kernel for sun4c srmmu[%s]/iommu io-unit Trying to set f fixup %p to invalid function %08x Trying to set b fixup %p to invalid function %08x Trying to set s fixup %p to invalid value %08x Trying to set h fixup %p to invalid value %08x Trying to set a fixup %p to invalid value %08x Wrong address for %c fixup %p Fixup f %p refers to weird instructions at %p[%08x,%08x] Fixup b %p doesn't refer to a SETHI at %p[%08x] Fixup s %p doesn't refer to an OR at %p[%08x] Fixup h %p doesn't refer to a SETHI at %p[%08x] Fixup a %p doesn't refer to a SETHI nor OR at %p[%08x] Fixup i %p doesn't refer to a valid instruction at %p[%08x] flush_cache_all undefined in btfixup() Garbled CALL/INT patch at %p[%08x,%08x,%08x]=%08x 32bit SMP kernel only supports sun4m and sun4d bYuvwyzpz|},<UVVWxWXXXY|[]^_Li`@tpIĀsyh|}hv| * q0 X p$@`DXEtyDzXBCdb[[_\bh0h ^t`c\glitL|l(-i@4 h H 4,`8L|@l4,HT %*(,l0P< =p@PBHtJNOdP0biDr xxx$,DH,-/35`dX  $"4LjʴX$xlD$h |f u%xf|}8f}}lf l(n4f L%pfV4V`VW0WX\XY<YhYfhB8h8pHdǬȀɌDΔ4H   $ x!""H#P#t#-d/2@245dIJLOT<Tmdh8#(\*0*|K<Nal`n|qv,vwxyz{{t~x@`@|P8|x |,l$D\pԼֈL0 ݔD@PD6d9:dLqr@|<$FNZ4ag|gjDqrDsuxLÐô@Ŭ@ɀˬxӬ Ԍ՘8TD*-4-ENRRZHZ[\hghjkXlHmxoz{4{|@}OD,ά|Td  P  L  (/02l3Pot  @ d \ 8 P x 0 p 1 2 3( 3 4 6$ :T @` AH B4 Bp B L _ `@ j  8 Q | |l 0 x T l d   h V W8 e f T $  ט )T*,h,--./ddxPln0ydyD4LPRU0UVWPWYpdvw4wxxp\P@x d \] ]l^`a|bb<bgut dX 8(LP ,Ĕlp@ؘوڸXl( <$Pd    P PHl$133455k\k4 l   tTHx.0QDSLSpSSSTpUUVW4WaTb(bcc8h80\H4tH(@4==@`@AF`GlKKLLPLLMTNNwHPX4flfffpffDZPXf@L-dh0 0h \@R`etfLl n,J4T\$f"-hP\t@RelTxh!xf p|dp@ReltŘ !f ARelŸx!f.-L8AHRel <!h8(-0PLl ASefxloDJy0!f p,AS8emd$D"f L4ASXfm$D"4f.-T@LBSpf$m<\ XD"Lf8.l0D BlC8SmƔJ@y$"fDX\ <x4LBBC\mƨyP,$H(""f ,|  &<` ~xA@ `pxx9> q5@p``q` pxx5 q5@``q` px x;   |,@X `` U`U`UxZ`xB| 5A"  ;"@j !!"|~h䠌 @`6p q@ @ 2@x x ?x !p |h~ qp. qpppÀ qp @ px~~~ #<~X|0}8?@@ا|-xPxy "%k%%&e&'D S%Jx |pp?p0@ p3p\py*Kqxx Fx$(pxx-^Ipx~xxx x`xx[ x$Ippp35pxx-^oqx~xxyxx`xx[ x$oppp35pxx-^qx~xxyx qyx x`xx[ x$ppp35pxxKx-^p hxox,,Phxn A xx-^xp\ hox,,P`` hx 1 Ax- xt@@5 0qD*H 5!de!qFpp?xv@5qD&xqF%h%Xu>,P`4gw6?@/!@@g @/`g hna@?`HB@BxHp `"g k6 ` HpJ`pN`pR*`xFx-^kpL@s@u@{ {@g xqL@) !H "H  H@z@x-wja >,d@``` ~*``` xx-^*`ay@q. ~qP@ݡ@x*ݡ@x)p`@桍yZix`(xxahhx~~~ ,x Shx~xm}}n~~x0`` x-wxr*xIx-wx;j zZxIx-wr%@;yIp2G``xQ0000QQQxxx ~ y5x@yphpxpwp hhhhhp~ q@ 5+ x 5! 5 5+ ppxpx.  9x+pxp yx !5W$@ƭh "xhox,x(xpT `h`jhhx !?x !5Wx !>x px a6`a``pxpp?x~$@ hh~jhhxx  #|P#x#y&)@/xpppy6>>@t)>t>xwx+wx,`@k !?  x@k~ !>~  x@j pjx[8Fxxwx,`@ !?   x@~ !>~   x@ pxx"yxppx"yxx$p(x(`` x(@(x$@ h-~h@- x "ihhx```` x(|x#y 5xx   0 xIxx전@!y # )  -X-X  /xp@ x"x+xUxx+xxx+xxx+xx _x$py > F S F( H( F Fxqp Qx)x(x(`` x(@(xx   0 nxIxx전@ j!y x -X-X -Pxx+xUxx+xxx+xxx+xx#y xx&ehxy䡄0@&ex전@&ey # ) -0-X-X -PxP x#y """y "xxx H+j+jy +j+j+j+ xy@ @ x+jp x'R+jy!!!!.!0!+j+j!+j+j""+j+j+j"x@!% x:xxh@!,hx-0xii!Jh!Rh!Bh@!xXx@!RxXx`@!@!!`x!z~Znxtzyx!m?k!hk"h@@!~Znp!x/:x0xgxx1jilk"@!""!|{#!@~Znxgxxg"!x0xx1xxjxxXxxx"!i@!ܡi ~pH ````` x"@"i ~pH ````` ,H @"x,x)@"x`(x~X~Z" xUxxix~X"xXxxjxx+px+p y@"xx"D#| @"<H"<x">x!$z">x"* "#@"TH"Tx"#@"hh~X 0~Z`` ~pH `` ,H @"xx,x*x" ~pH `` ,H @"x,x)@"x`(x~Z"xUxxixzx"*#@"H"x"*+vx+px+vx+jxx@"xzx+jy"+j)9+j*g"xx+xix"xx+xixP"x#y""##@"x p:py### # %%0$##x#x.@#xh@#Z#)x(`` x(@#Zx.x#A(#Zx.`` `@#A`@#A@#A`h@hhpT ~ `h` `h-#W``x~x$hh'o@###w`@#wxzh.j*6"#x#" @#h#x$x@#@ih@#p8hix(x(#`` h#x(x#pT `h`xxH#x"y#####xp@#x+xixjxxxy@#x+jxjxhh$x+x$ @$ xx+xixx-wx0$$y||`$)h/h+x$$8hH5$8x.| @$bxЀ$Fx1xx1@@$Ph/h+x$5hH5@$Jp8$\yzi.j*x$5@@$lh/h+x$5hH5@$fp8$zp;yzxЀ$?i.j*!$x$5x1|@$`` hj(i,j:i>h+h/h3 hh py$$$$$$$$$xh$x(x$pT,P `h`*` !5W$@$ x$-" k|wx+x,`@% ~ ? h  !?  x@%~ !>~  x@% p%x$8$xx(x(h'xohx1ʦ@%i ih@%$h !5Wh "j8ix& ?!h- qVn`@'@'hhhx.x'@ @'x1xЀ'xx1yzx'x,x1@'@hxtx-| x-|  '8x-|'3?k!hk"hxx+vp3P'Lx#y'O'R'\'"y'U'Z+v'Z''xp'ix(x.p4` x'np@'cp ? hp>p2"y'x+v'}''}+vxp'x(x.p4` x'p@'p ? hp>p2"y''''''xx+xixp'x(x.p4` x'p@'pzx| i?--qV h@'h@'hx'p ? hp>p2~ / p'x'jhhh#n~Zh @(Ox+x(Op(x(x.p4` x( p@(pzx|yy>--qV h@(*h@(Chx(p ? hp>p2~ / p(;x(4jhhh#n~Zh @(Ox+~Xx(O~6 `pJ`pN`pR`@(klih(t{{||ަ~Zx0x(h!#$@({{||h~Zx1x, j@( i ~Zy-p>6 Hx` @(`"`` p`&|x.hhh@hpy(((((((((xx(x(xxpxhx%h(``|`@((x``` |`@(`|x-whx)&x-whx)&x-whx)&wx,q>-- h)xhr@) hx)h hpx(h)/x(x(hh xx+j}~ii@)i@)H)Z@)Z 1++x,$@)dx*3x)x+ ~)```x*W ii~X~Z)xUxxix ~)```x*W ~X)xXxxjx ~pH `a@)bH)@) &)"0bp()¢) x)Ȣ )  ")"(x+++x,$@)x*3x)x+x*WxXxZ xix ~)``*`))a | 2 x*#bp(** x* *  cH*#@*# xxxz{hh | ~qH!` 5~`x~fxx`x7``` | ~pH ``xxx`xx |+jzii@*i+jx*x*W x,x)@*x`(x~X~Z*xUxxix~X*xXxxjx*@*qH! * x+x*x*WxXxZxix ~~)``  *`@*ᡌax* xxxzhh | ~pH `@* @`xxx`x`` |~p@+x+x+f @+fx@@+fx@+%{?+,@+M+5@+bx1xx1x+f@@+Mx+F?+b~Zyz +Vyyzzx1xgx0^xxgxxjxx+xixx+xixh#x+i ih@+hxix x+  x+ x+  x+  x+ xx~Z|~?;;6 y@+x```88y@@+ϡx```|xxxxzx`x| 1 )2xxxx}~x`x|~ xy 5F (@, !,  x, !,  d$@," #p,"x,|~ 5F"2H,8@,< !,v   2x,L(@,D !,  x,J !,  d"@,\H,\ #p,Yx,L|d,expx x전@,s$,s !x,t$|02BDTVfhxz  2BRbrfvxz|~"2BRTdtvxz|~xF| 6|yzxЀ,?|~ y 5@ !y,,,,,,,,,xxKxH,xKxH,h@hxX@xZx0,,h ,xx,x | ~h6` -.a@-. @- 2@-!x-% x-' ?x-' !` `` |xjxxixxXxxUxxxxxxxxxxxxxpxFx~x0-uxx x전!@-uxx |xx |x0@-|-x|xx x전!@--x~xx |p@- ~-`/hxk-x,h hxX?hh/h+xKx  @ x전@  x+p ~h6 ` HpJ`pN`pR | b G  0 8~*89(œèd;0(â0 (GajV:(✠d)0 0(ᜠ( dgo;p#vwxn> (+dgo;p#vw> i( D! ܢr<no00 Ht.?a22!ℨhe*#`B`*!0 ׈"(H0(0(= 0 &:  ~*8~ " I.prr p@.x.p |p/ q.x/x.p @/ p/p.p@/.px/ @/ x1k/@.x/Vp |d$@/0,p 9/5'hh 0h)!@/08'/pu@/0 9/2x/| ~ " y5 qp pp q p pp Ix | I/Vp/pqp/^0@/k0/^p/p /q //Vx/hppp/pqH/xp I|~~~~ "qx/ |r!qp /ꡄ / y/////////xp/ Ix/x1k/x|p/x/x1k/x|px/Vx,h@/h|xxx0Prqp (x@0xx03x0P',X`c ""c!$@0)0) +`x0+`/2=,holkpx/V|8'0D`@0M ` 9/2Q@0Lp| Q|P9'0] 9/8`d0]-`|~ ~ " h `hklW/2~ h@@0y~ yxX@@00pp0p@0x$0x0,X'``~p`p !0Ƞ@0Ȧ0ppvpx`p`pb $pb#pvp+`x08x0x1k0 |~ ~ " pp0p |~ ~ "  I0pp0p@1x~ h@@1h$@1 P 9/5-`x1k1 |~~~ ~ " ~ h@@10 I1h$U@1h-p.` 9/5'hh "hH1UQ1Gx8'1;pu `@1h 9/2x1:" i $"i#1dx q x0 |p@1'!p!p!p!p~ yxX@@11vpx08|~~ ~ " I1 q1h$@1x.x1q1x/x1pq1x/p1p1p I |~~~~ ~ "  I1ʭ 1p h&ppp@1Spp1 Ip |~~ ~ "  I1h `hklW/2~pp2,X'``p`pppvp 1 2,qp 2, H29x/ꤠklp Ip | 2Q2L|~ @2w2wH2j2k2_x2o#2_~2 |~2x2s2 `x x"2x$x" i5@h@2@2h0 @2!@2 @3o a6 `4@2`62`@2xp2x2x2x2x2 |x<x>2x@x>xH@2ӀxJ2x|x4x62x8x6 xD2 xF> @ e@2` @2`"@3(`,@x2|x(x*3'x,x*x03 x26#@3' "@3 3'# x| i5@h@32h<@3o``?````` Bgoxh@3Jhhh h3Txh`/`+,hx i5@ hyD3ji hx | 5O!d ixk`hX?``H``/`+h0@@3hK hH@3p3x3hK hH@3p3x3 p3x3hh hF 5h xLxJ | y5x4x3x3x3x3xGxK|  5F"2@3  "<@3 {*{.| 0 5F"2@3 9"<@3 '{6{:|  5F"<@4  {>{B| / 5F"2@4 9q"<@4 &&{"{&|:&zfJZ6**FښV:bΦֆުj~ھVjJNފ~Jb^rvzrҲ~R2 꺂nr>B^"Nb.:&zfJZ6Ʋʊ> "*Bf*&V6Fjzb:F2Z枦 VF&^>*N.~jJFrRvҾf>6^jzvV&֞Zºn~fֆJ6VjZj2NJ^vrvjVJҲ~R2 꺂nr>B^"Nb.:&zfJZ6ڮzbVYfj|Rf*&֊rvZFr^R~j nW 2  . zv"j~bή6V^gֺҚjNF j &bv^bZNҲ~R2 꺂nr>B^"Nb. !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!"""""""""""""""""""""""""""""""##################$%%%%%&###################### !"""""""""""""""""""""""""""""""#################'''''''%%&###################(!)""""""""""""""""""""""""""""""""""""""""""""""*'%%%%%%%'+'',"""""""""""""""""# )"""""""""""""""""""""""""""""""(((((((((((((((%'''''''%-./''0(((((((((((((((#(!!"""""""""""""""""""""""""""""""#############"1'%%%%%%%'2342%%$"#############"# )"""""""""""""""""""""""""""""""#############"%'''''''%''%''''5#############(#(!!"""""""""""""6789:;<=>?@"""""""""""""""""""#"'%%%%%%%'%%'%%%%+A""""""""""""#"# )"""""""""""6BCDEFGHIHIJC;>K""""""((((((((((("'''-'''%''%-''''%1(((((((((((#(#(!!""""""""""7LHFMMMMFFFFMFNIO8P""""#########"""%%Q2Q%%'%3R&S%%%'T"##########"#"# )""""""""6UVGMMMGWXYZ[\]^MMFHY_""""#########""'+11`'%'R$a1+''%%T"#########(#(#(!!"""""""bcWMMMFdZefKbbKeghiMMFDU6"""""""""#"((%j1a"%'Q"k-lk%%''m""""""""""#"#"# )"""""""nHMMopq;f"""""""@rsWMMMt;"""((((((("""'a'."2446'2`"'%%'j(((((((((#(#(#(!!""""""e]MMuv>@"""""""""""@BXMMoh"""#####"##"(%A'-1wwxy%'2(%''%j"########"#"#"# )""""PbzGF{|f"""""""""""""""8}MM~""########"(%5/xx'k*%%'%5########(#(#(#(!!""""e\Mu""""""""C>b#>P""""MtK@"#######(6"'-'%`'%k#####(#(#(#(#(!!"""<~b"""""""CU@"""""#"""@zM"6"""#"((""#"%'1%''-"""""#"#"#"#"# )"""I|"""""""K!U6""""""""""")MN""(((""####6%-11$*4'-/%'R(((#(#(#(#(#(!!"""NJ""""""">f"""""""""""cM^"(#"###(#"@y'-a1101*6(y%%''%%$##"#"#"#"#"# )"""9N?"""""""9b""""""""e"""gM"#######((##%%Ay0111$l6""6%%'''5#(#(#(#(#(#(!!""6:\"""""""ghf"""""""""""")~C@""#"((""#"-'`"6y111*66"#(""''%%%'A#"#"#"#"#"# )""6Z""""""""!]e""""""b@""Kv9@((""####3%%6@666yb""#""#""+'''%%%"(#(#(#(#(!!""":E)""""""""}=""""b@76"6!HL7"#"###(#"0''####@6""##(###"5%%%'''/"#"#"#"#"# )""":q""""""""U|"""bB""""e>b"#####(($%%%1"####y(#(##((lya''%%%''/"(#(#(#(!!""":X"""""""zr"""""##"(("""$'4'$6"("#("("#(####@"(6"2&%%%''1"#"#"# )"""fVMME""""""""""#f?""""""(((""##(6&2'-"####"#"#""#(###"""""*-''4%%'.*(#(#(!!""""MM~6"""""""""""""""""""""###(#""'S%1##"((#(##(#("#(####("(%%%S''%-$#"#"# )""""HMM?"""""""""""""""""""#####(#"'-'6(##"###(##"#(""(###("6''%S%'%'1(#(#(!!"""""L^Mu"""""""""""""""""""#"(("""l%2%Q#"("#("("#(##"#(#((""#"%%'Q'%'%T#"#"# )"""""\MMt<""""""""""""""""""(""##("4'-'k####"#"#""#(###"""##"""-%'S'%'%5"(#(!!""""""BWMFO?"""""""""""""""""###(#"*%%Q%A#"((#(##(#("#(####(#(#(S'%Q%'%'5*"#"# )"""""""}M~C?""""""""""""""""###(""1''4%*(""###(##"#(""(###(#(""Q'''%'%'5("(#(!!"""""""@dMi"""""""""""""""((""#(%%%-l"##("("#(##"#(#((""#"#"-%S%-'%'5"##"# )""""""""6_\op6""""""""""""""##("(*%$"#"#"#""#(###"""##"##""'%'%%'3'j6#(#(!!""""""""""7c{Cf""""""""""""#(#"#"a'A(#(##(#("#(####(#(#w'%'''&2T#"#"# )""""""""""""bMH"@##""#@@####@"#$1TTk6#@##(#"(#(!!"""""""""""""l&'+""""""""""l%'"""#(""#ciMM"#"#########@#@#@#""@#"#("""(#"# )""""""""""""""'"""""""""""%'""""""""r[iV"""""""""""""""""""""""""""""""" !""""""""""""""3'4"""""""""""m'"""""""""r9"""""""""""""""""""""""""""""""""!)""""""""""('&"""((""'"(("""""""(""""㫫"""""""""(""""""""" !"""""""&'&""'Ʈ,""m"(Rm""m,("""""""!)""""""2'''''''/''%'''é'''%`""&%'''''(2-R''''""""""" !""""""'m2'&''4T0%%'-''%ϫ''"2,'Q"'/3''"""""""!)""""""'',(((/'&'%(""%'+-'-''"('-"`'ϫ(Q'%""""""" !""""""''""""/'ة'-"""+''+""''0''"""""""b'-"'""/'%"""""""!)""""""''""""`''2"""+''"""''''"""ڮ'"l'2""'%""""""" !""""""''""""`'&'/''"""''''"/&444-'-"'2l""''"""""""!)""""""'%""""`'&'''"""''''l'+'-"l'2""''""""""" !""""""''""""''TTT'"""(''''l&'Q""'-"l'l""'%"""""""!)""""""''""""&'3'"""""""'""",''A''lQ'"""'-"l'2""''""""""" !""""""''("""'&'"""""""'"""''''3"""'-"'l""'%"""""""!)""""""''`""(+'&,'"""""""'"""3'.'''"""'-"/'2""''""""""" !""""""''%׮-'A''(('"""A"3''AQ''-"`'l""'%"""""""!)""""""''+'+'%&R%'Ʃ"l''/'%QQ'"'2""`''""""""" !""""""%''''/'(4%'''''T%'2-'`""''('''%''0"4'2""4''"""""""!)"""""""lRR"(,l"""ܮ"(0"0l""(00l""""""" !)))))) !!))!!! !!!) !) !))!! )))! ))) )! )!)!!!! ! !!) )!!))!!)!!))))))))!255 20u>+YybT ##"22##"22##"22#########################$DDDDDDDDDDDDDDDDDDDDDDDDVfftDDDDDDDDDDB$DDDDDDDDDDDDDDDDDDDDDDDFfffftDDDDDDDDDC4DDDDDDDDDDDDDDDDDDDDDDHffffgfDDDDDDDDB$DDDDDDDDDDDDDDDDDDDDDDFffffivjDDDDDDDDC4DDDDDDDDDDDDDDDDDDDDDDffffiwfTDDDDDDDB$DDDDDDDDDDDDDDDDDDDDDDffffffffDDDDDDDC4DDDDDDHU(DDDDDDDDDDDffffffffuDDDDDDDB$DDDDDH;8DDDDDDDDDffffffffjDDDDDDDC4DDDDD<ܻTDDDDDDDDfvvfivfjDDDDDDDB$DDDD[۳3TDDDDDDDgvfvfjDDDDDDDC4DDDB8DD+ݵDDDDDDDbFgJh&fiDDDDDDDB$DDD,8DDDDD+ۄDDDDDDeiFwFwFfjDDDDDDDC4DDH8DDDDDDEܴDDDDDDefWwfFfiDDDDDDDB$DDCݵDDDDDDD\DDDDDDiwjfiDDDDDDDC4DH˄DDDDDDDDCDDDDDDgvfiDDDDDDDB$DDDDDDDDDDH(DDDDDDgfgDDDDDDDC4DE$DDDDS3"DDDDDDDDiOffDDDDDDDB$D̄DDDETDDD=DDDDDDfgfDDDDDDC4DDDDDTDDDDD=DDDDDDf)idDDDDDDB$D\DDDD5DDDDDD-DDDDDDffviDDDDDDC4D\DDDH4DDDDD-DDDDDDf)DfffTDDDDDB$D,DDDJ8DDDDDD-DDDDDFeJ*XDDffDDDDDC4D+DDDBDDDDDD<4DDDDDftHDDDFffeDDDDDB$D4DDDCDDDHDD$DDDDIfDDHDDDDGfffDDDDC4D,$DDDBDDDHDBDDDDDiDDDDDDDIffftDDDDB$D4DDDEDDXDDDDDEfjDDHDDDHEfffgDDDDC4D,DDDH3DDDDH;DDDDfiXDDDUffff(DDDB$D\DDDHS$DDD;DDDDD&fzDDDDDDUwffjDDDC4DDDDDB3ÄDDDDDfvDDDDDDDHfvfiDDB$D\ӄDDDD;3$DDDDDDffDDDDDDDDDfwfgTDDC4DܸDDDDH3:DDDDDDDEgeDDDDDDDDDDvffDDB$DKDDDDDDDDDDDDDDGvdDDDDDDDDDDfvfDDC4DBDDDDDDDDDDDDDDFvDDDDDDDDDDFfvfeDDB$DDDDDDDDDDDDDDDDfDDDDDDDDDDDFfvfjDDC4DD?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|%}~0(D@d({4. !e ^# +" '* $+$ +$ '* $p 1Q " h  p00@@PP``p0`@p  @\(l